Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NEY8
Symbols Ybakd1
Prdxdd1
PRDXDD1P
NCRNA00117

Gene

 Compartment GO Term (0)

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MAGAELGAALEQRLGALAIHTEVVEHPEVFTVEEMMPHIQHLKGAHSKNLFLKDKKKKNYWLVTVLHDRQ      1 - 70
INLNELAKQLGVGSGNLRFADETAMLEKLKVGQGCATPLALFCDGGDVKFVLDSAFLEGGHEKVYFHPMT     71 - 140
NAATMGLSPEDFLTFVKMTGHDPIILNFD                                             141 - 169
//

Text Mined References (4)

PMID Year Title