Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NEY8
Symbols Ybakd1
Prdxdd1
PRDXDD1P
NCRNA00117

Gene

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
23210460 Human cytoplasmic ProX edits mischarged tRNAPro with amino acid but not tRNA specificity

AA Sequence

MAGAELGAALEQRLGALAIHTEVVEHPEVFTVEEMMPHIQHLKGAHSKNLFLKDKKKKNYWLVTVLHDRQ      1 - 70
INLNELAKQLGVGSGNLRFADETAMLEKLKVGQGCATPLALFCDGGDVKFVLDSAFLEGGHEKVYFHPMT     71 - 140
NAATMGLSPEDFLTFVKMTGHDPIILNFD                                             141 - 169
//

Text Mined References (4)

PMID Year Title
23210460 2013 Human cytoplasmic ProX edits mischarged tRNAPro with amino acid but not tRNA specificity.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11181995 2001 The sequence of the human genome.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.