Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.04

Knowledge Summary

Patent (21)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

AA Sequence

MNKENHSLIAEFILTGFTYHPKLKTVLFVVFFAIYLITMVGNIGLVALIYIEQRLHTPMYIFLGNLVLMD      1 - 70
SCCSSAITPKMLENFFSEDKRITLYECMAQFYFLCLAETTDCFLLAAMAYDCYVAICNPLQYHTMMSKTL     71 - 140
CIQMTAGAYLAGNLHPMIEVEFLLRLTFCGSHQINHFFCDVLPLYRLSCINPYINELVLFILAGSIQIFT    141 - 210
IVLVSYFYILFTIFTMKSKEGRGKALSTCASHFLSVSIFCDSLLFMYARPGAVNEGDKDIPVAIFYTLVI    211 - 280
PLLNPFIYSLRNKEVINIMKKIMKKRKFCHILKQMSSPLAT                                 281 - 321
//

Text Mined References (1)

PMID Year Title