Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.04

Knowledge Summary

Patent (21)

AA Sequence

MNKENHSLIAEFILTGFTYHPKLKTVLFVVFFAIYLITMVGNIGLVALIYIEQRLHTPMYIFLGNLVLMD      1 - 70
SCCSSAITPKMLENFFSEDKRITLYECMAQFYFLCLAETTDCFLLAAMAYDCYVAICNPLQYHTMMSKTL     71 - 140
CIQMTAGAYLAGNLHPMIEVEFLLRLTFCGSHQINHFFCDVLPLYRLSCINPYINELVLFILAGSIQIFT    141 - 210
IVLVSYFYILFTIFTMKSKEGRGKALSTCASHFLSVSIFCDSLLFMYARPGAVNEGDKDIPVAIFYTLVI    211 - 280
PLLNPFIYSLRNKEVINIMKKIMKKRKFCHILKQMSSPLAT                                 281 - 321
//

Publication (1)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.