Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 5.3e-22
medulloblastoma, large-cell 6241 3.1e-04
interstitial cystitis 2312 1.2e-02

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.600 1.2e-02
medulloblastoma, large-cell 1.100 3.1e-04
psoriasis -1.500 5.3e-22

Gene RIF (1)

AA Sequence

MTEAITEAAVASSEEVSEERDDLGPLELHDSGTFQQVVNLLDIIDSESAKTDTTGAGLDMRKTLASVIIM      1 - 70
EKATTEPSVVINTLIRCLQVPEISTQRKVNIYNILQDIIQQEGELEEQCVQRLVAIASKEMREIPEMEGY     71 - 140
MKAEVASDTLVALSRNHFSLVMYELQHHLKPLNLTDEFVIITLAKLANGNVFEFMPYMGITLATIFTMLR    141 - 210
LANEAKIRQAICSAMETFCETVQFYLKHLEESVYPVMTEEEFALKVFPMYRYFVTVWLRHYNPEVKLGVI    211 - 280
KSLKPMLGLLLPNDDLREQVYDYIPLLLAEYQGSLEVLFVTQVLRQILELSVTTNTPVPQMQLHTIFTEL    281 - 350
HVQVCNKAPAQHQYSSQNLMEMVHCFVALARSYPKELMKFFFSQMETNKEAVRVGTLNLIRAIVSADEPR    351 - 420
MSIRAIYLAIRVVKNTISDTRSKVRMAILHIIGQLALCGYQERIKGWGLKYLSVQLTLSTYKLTNRREKF    421 - 490
YQRDLEERMVHKVTMDTVKIITSSVSGMTTEFWVRLLCYIMETDYVEALTPICISLTNLAEHQLHGQDVD    491 - 560
VSVAGKSRQVDLPAPQKLLARLLVLMSSPYKGEGRGIAMLNLLRTLSQSIAPSMADMWELEIALLVRYLE    561 - 630
EHTEFTWDQKAWEDKLIQFLRNSLKKTRGSSWSLRLSKELNNQIASFDSPSLEKGFLYRALGFTLATGLE    631 - 700
ASKVEVLLLELLYKTDYSNDFDSEGVIMCFGLCARGQVKTVLNVLHDFEERIQESEQSWQISAWRKDHPW    701 - 770
RRETVKSALMVMYSCVASYCHPQLLLNLVDSPITAKIIHHYVSSCQDICLKMAFMKSVVQVTKAINNIKD    771 - 840
LEDFHFAQKTTLTSIIVAVIKAEPTDNLVSPVRALAMEALSHLSKLKPFYSTEENSELMDISIHSVISLQ    841 - 910
LPGEDNESIKTLYANALSSLEQLMESLLQRQLDPKGLQEMVQLLEKWILSEKEWEREKAVSLHLYLMWIY    911 - 980
VHSTAVCIHLKLGQFGTMVGLIAPCTCDAHQRTRMASMNVLSSLLDLHASQTCSLWGPSKQKELEKCKGD    981 - 1050
LQSTDVEKIFCASSRIAKVVCMEFSCDEVVSLIQKLCENTGAMNLQHDKASVTWIAFFLQMRAKELEDKV   1051 - 1120
AEILSAILVHLPVVDHPEVRRLLIDGILLLAHHHQETILTSLLRQPLPMESHLAEVWLAVSENVPFARTM   1121 - 1190
LHSLMGRLQSRLSPRISATSKADIWRLAAVDPLMTLCTIHLLIQKLDENDKLPDFLPDLIYTLLLQLGSS   1191 - 1260
HRPEAAPPVLKMWKLVHTTPLPEEMNLQRVTIKSMQLLFKRVKSQHLAHTLDEQAVWDLLQDGGTFLEGV   1261 - 1330
SLLARLCMQHVEGHRQRLAELVLRGMDSEVLSCRISSTAVCFMSGPVLYQEKLLKPAALLLEKGADQEED   1331 - 1400
EALRVLSLRALGNMALGAPKKVKQYRKVLLEKCLGPLREPVSNSVTAEGMEALTKILAELREGDVGSSFD   1401 - 1470
AMSEQCRIFFDNESELLRLKAFILFGKLARVVGMSKKHFFKGEVKKAWIPLMLHSQDPCSNAAQACMATM   1471 - 1540
FQCVHFWGWKSLEHPSGPSDTATDDKMTVFQTTMCSILTRKKPAVLYRFLLETMAYVKNNLSRIRIAACN   1541 - 1610
LAGIIMKQMSTHYLKKLDFPALRNSLQELQLDPDPGVRRAALETLTVLDSCSQHGFLASPQGMS         1611 - 1674
//

Text Mined References (5)

PMID Year Title