Property Summary

NCBI Gene PubMed Count 16
PubMed Score 0.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Cancer 2,346 4.0

Gene RIF (2)

PMID Text
16863688 We describe eight highly related TBC1D3 paralogues located on Chromosome 17q12 that display specific transcription patterns in human tissues, and that pattern is altered in several primary prostate tumors in comparison to healthy prostate tissues.
12359748 PRC17 is amplified in 15% of prostate cancers, it is highly overexpressed in approximately one-half of metastatic prostate tumors.

AA Sequence

MDVVEVAGSWWAQEREDIIMKYEKGHRAGLPEDKGPKPFRSYNNNVDHLGIVHETELPPLTAREAKQIRR      1 - 70
EISRKSKWVDMLGDWEKYKSSRKLIDRAYKGMPMNIRGPMWSVLLNIEEMKLKNPGRYQIMKEKGKRSSE     71 - 140
HIQRIDRDVSGTLRKHIFFRDRYGTKQRELLHILLAYEEYNPEVGYCRDLSHIAALFLLYLPEEDAFWAL    141 - 210
VQLLASERHSLQGFHSPNGGTVQGLQDQQEHVVATSQPKTMGHQDKKDLCGQCSPLGCLIRILIDGISLG    211 - 280
LTLRLWDVYLVEGEQALMPITRIAFKVQQKRLTKTSRCGPWARFCNRFVDTWARDEDTVLKHLRASMKKL    281 - 350
TRKKGDVPPPAKPEQGSSASRPVPASRGGKTLCKGDRQAPPGPPARFPRPIWSASPPRAPRSSTPCPGGA    351 - 420
VREDTYPVGTQGVPSPALAQGGPQGSWRFLQWNSMPRLPTDLDVEGPWFRHYDFRQSCWVRAISQEDQLA    421 - 490
PCWQAEHPAERVRSAFAAPSTDSDQGTPFRARDEQQCAPTSGPCLCGLHLESSQFPPGF               491 - 549
//

Publication (17)

PMID Year Title
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
21030649 2010 Diversity of human copy number variation and multicopy genes.
19077034 2009 Identification and characterization of a novel Tre-2/Bub2/Cdc16 (TBC) protein that possesses Rab3A-GAP activity.
16863688 2006 TBC1D3, a hominoid oncoprotein, is encoded by a cluster of paralogues located on chromosome 17q12.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16381901 2006 The LIFEdb database in 2006.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12359748 2002 PRC17, a novel oncogene encoding a Rab GTPase-activating protein, is amplified in prostate cancer.
More...