Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
astrocytoma 1493 1.73238376276773E-19
posterior fossa group B ependymoma 1530 2.51555319702676E-7
pituitary cancer 1972 3.53144066580923E-7
sonic hedgehog group medulloblastoma 1482 1.50683126728032E-6
interstitial cystitis 2299 9.81141043609848E-6
medulloblastoma, large-cell 6234 4.1206844295185E-5
non-inflammatory breast cancer 208 6.12967859399602E-5
oligodendroglioma 2849 0.00370251872652893
urothelial carcinoma 318 0.00556620020129256

Expression

  Differential Expression (9)

Synonym

Accession A6NEQ2 B2RWP1
Symbols

Gene

  Ortholog (8)

 Compartment GO Term (2)

AA Sequence

MAVQAALLSTHPFVPFGFGGSPDGLGGAFGALDKGCCFEDDETGAPAGALLSGAEGGDVREATRDLLSFI      1 - 70
DSASSNIKLALDKPGKSKRKVNHRKYLQKQIKRCSGLMGAAPPGPPSPSAADTPAKRPLAAPSAPTVAAP     71 - 140
AHGKAAPRREASQAAAAASLQSRSLAALFDSLRHVPGGAEPAGGEVAAPAAGLGGAGTGGAGGDVAGPAG    141 - 210
ATAIPGARKVPLRARNLPPSFFTEPSRAGGGGCGPSGPDVSLGDLEKGAEAVEFFELLGPDYGAGTEAAV    211 - 280
LLAAEPLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPL    281 - 350
SPLYPAAADSPGGEDGRGHLASFAPFFPDCALPPPPPPHQVSYDYSAGYSRTAYSSLWRSDGVWEGAPGE    351 - 420
EGAHRD                                                                    421 - 426
//

Text Mined References (4)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.