Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
lung carcinoma 2843 2.6e-19
osteosarcoma 7950 6.2e-09
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
lung carcinoma -1.200 2.6e-19
osteosarcoma -3.930 6.2e-09

AA Sequence

MFIFIKHGDNQQFLVNTNCAVVVLLYYIRSKVKLPKTNTIDLCEQTGKMKMLFLMKPNHAEYASKYLTAR      1 - 70
STYYVCKVERGPPGTRLENAYRAFVPLLKNPEPWLLVALRIQCDALERRRIQMLKMKEAKKVVIIEPPAS     71 - 140
VPSKQSGRSDKKKSTRKSPTFRNRPDFRKNKGRQLNKTTKQKK                               141 - 183
//

Text Mined References (3)

PMID Year Title