Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
lung carcinoma 2,844
osteosarcoma 7,933

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -3.930 0.000
lung carcinoma -1.200 0.000

Synonym

Accession A6NEN9
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MFIFIKHGDNQQFLVNTNCAVVVLLYYIRSKVKLPKTNTIDLCEQTGKMKMLFLMKPNHAEYASKYLTAR      1 - 70
STYYVCKVERGPPGTRLENAYRAFVPLLKNPEPWLLVALRIQCDALERRRIQMLKMKEAKKVVIIEPPAS     71 - 140
VPSKQSGRSDKKKSTRKSPTFRNRPDFRKNKGRQLNKTTKQKK                               141 - 183
//

Publication (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.