Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MAPEENAGTELLLQSLERRFLAARALRSFPWQSLEAKLRDSSDSELLRDILQKHEAVHTEPLDELYEVLA      1 - 70
ETLMAKESTQGHRSYLLTCCIAQKPSCRWSGSCGGWLPAGSTSGLLKSMWPLPSATQRRASCSPLSYAGL     71 - 140
GSDGKWNLVMTRNCFPTKSTWRWQC                                                 141 - 165
//

Text Mined References (4)

PMID Year Title
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.