Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NEK1
Symbols

Gene

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MGDREECLSTPQPPMSVVKSIELVLPEDRIYLAGSSIKGQVILTLNSTLVDPIVKVELVGRGYVEWSEEA      1 - 70
GASCDYSRNVICNNKADYVHKTKTFPVEDNWLSAGSHTFDFHFNLPPRLPSTFTSKFGHVFYFVQASCMG     71 - 140
REHILAKKRMYLLVQGTSTFHKETPFQNPLFVEAEEKVSYNCCRQGTVCLQIQMERNTFTPGEKVVFTTE    141 - 210
INNQTSKCIKTVVFALYAHIQYEGFTPSAERRSRLDSSELLRQEANTPVTRFNTTKVVSTFNLPLLLSVS    211 - 280
SSTQDGEIMHTRYELVTTVHLPWSLTSLKAKVPIIITSASVDSAICQLSEDGVLPVNPDHQN            281 - 342
//

Publication (3)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12886014 2003 Polyserase-I, a human polyprotease with the ability to generate independent serine protease domains from a single translation product.