Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession A6NEH8
Symbols C10orf41
NCRNA00245

Gene

 Compartment GO Term (0)

AA Sequence

MGVWGKKHLRLTHAPSPTFSHLPPSPQAGEPGIDGISLAVVCAAFIRIHPARRHPARNGSRLACTPTPRP      1 - 70
NAGLEVVSSARVAASLPSEGGWTSGAPRSSGLSLPGSAWQPPPLPVLRKPAWPGSPAVKNESKFPNRGSR     71 - 140
NFPRRRLPPAPVSGEPPERCKLAREIRWRLWKAHEGWGGGAKRPLGDPAWSGVKR                   141 - 195
//

Publication (5)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.