Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 2.2e-05
group 3 medulloblastoma 4104 4.5e-03

Synonym

Accession A6NEH8
Symbols C10orf41
NCRNA00245

 Compartment GO Term (0)

AA Sequence

MGVWGKKHLRLTHAPSPTFSHLPPSPQAGEPGIDGISLAVVCAAFIRIHPARRHPARNGSRLACTPTPRP      1 - 70
NAGLEVVSSARVAASLPSEGGWTSGAPRSSGLSLPGSAWQPPPLPVLRKPAWPGSPAVKNESKFPNRGSR     71 - 140
NFPRRRLPPAPVSGEPPERCKLAREIRWRLWKAHEGWGGGAKRPLGDPAWSGVKR                   141 - 195
//

Text Mined References (5)

PMID Year Title