Property Summary

NCBI Gene PubMed Count 7
PubMed Score 7.03
PubTator Score 1.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.299 0.001
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.204 0.000
group 3 medulloblastoma 1.400 0.000
lung adenocarcinoma 1.100 0.000

Gene RIF (1)

PMID Text
24981860 RCCD1 and KDM8 form a histone demethylase complex.

AA Sequence

MAEERPGAWFGFGFCGFGQELGSGRGRQVHSPSPLRAGVDICRVSASWSYTAFVTRGGRLELSGSASGAA      1 - 70
GRCKDAWASEGLLAVLRAGPGPEALLQVWAAESALRGEPLWAQNVVPEAEGEDDPAGEAQAGRLPLLPCA     71 - 140
RAYVSPRAPFYRPLAPELRARQLELGAEHALLLDAAGQVFSWGGGRHGQLGHGTLEAELEPRLLEALQGL    141 - 210
VMAEVAAGGWHSVCVSETGDIYIWGWNESGQLALPTRNLAEDGETVAREATELNEDGSQVKRTGGAEDGA    211 - 280
PAPFIAVQPFPALLDLPMGSDAVKASCGSRHTAVVTRTGELYTWGWGKYGQLGHEDTTSLDRPRRVEYFV    281 - 350
DKQLQVKAVTCGPWNTYVYAVEKGKS                                                351 - 376
//

Publication (8)

PMID Year Title
25038754 2014 Genome-wide association analysis in East Asians identifies breast cancer susceptibility loci at 1q32.1, 5q14.3 and 15q26.1.
24981860 2014 Human-chromatin-related protein interactions identify a demethylase complex required for chromosome segregation.
21269460 2011 Initial characterization of the human central proteome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.