Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
adult high grade glioma 2,148

Expression

  Differential Expression (1)

Disease log2 FC p
adult high grade glioma -1.100 0.001

AA Sequence

MEAEVWEAEGYNLVLDSDLYDADGYDVPDPGLLTEKNELTFTEPSQVLPFLTSSQQWQSLTPRARARRLW      1 - 70
LLLRTSLHEVVEKEKRAELRAARLTHGLEPLRRLEVAAGLRSVAQDPVGGRFVVLDGAGRLHLHKEDGWA     71 - 140
QETLLAPVRLTGLVTVLGPLGAVGRFVGWGPAGLAILRPNLSLLWLSEQGVGRAPGWAPTCCLPVPDLRL    141 - 210
LLVAEMNSSLALWQFRSGGRRLVLRGSALHPPPSPTGRLMRLAVAPVPPHHVLRCFAAYGSAVLTFDLHA    211 - 280
WTLVDVRRDLHKTTISDLAYCEEVEAMVTASRDSTVKVWEADWQIRMVFVGHTGPVTAMTVLPNTTLVLS    281 - 350
ASQDGTLRTWDLQAAAQVGEVALGFWGQDKLSRRVGRLLAPVRPGWPVLSLCASSMQLWRVRELYSPLAQ    351 - 420
LPAKVLHVQVAPALPAPAHQSLPTRLVCACADGSVYLLSAATGRIVSSLLLEPEDCAAAVAYCLPREALW    421 - 490
LLTRAGHLVRANAARCPMSVLHRVCPPPPPAPQPCCLHLYSHLTDLEGAFSSWEIVRQHWGELRCSSVAC    491 - 560
AWKNKNRYLPVVGHTDGTLSVLEWLSSKTVFQTEAHSPGPVVAIASTWNSIVSSGGDLTVKMWRVFPYAE    561 - 630
ESLSLLRTFSCCYPAVALCALGRRVTAGFEDPDSATYGLVQFGLGDSPRLDHRPQDDPTDHITGLCCCPT    631 - 700
LKLYACSSLDCTVRIWTAENRLLRLLQLNGAPQALAFCSNSGDLVLALGSRLCLVSHRLYLPTSYLVKKM    701 - 770
CRKAPDVVDDPPLPLMSQESLTSAQLQRLTNLHGAASLSEALSLIHRRRATSQHLVPKEDLDAIVARDRD    771 - 840
LQQLRLGLVVPAAQPPPSWQQRQEGFDNYLRLIYGSGLLGMQSGRGSQQWSAGTLRVERETRDVCAVPQA    841 - 910
AHCLARAEVSTAAQTVPTALSPQDLGALGQHFSQSPRVTVPIPPTHRRVHSKASQLLARSSLSHYLGISL    911 - 980
DLQLQLEQLRGRTTMALDLPSSHLQCRIPLLPKRWDKEPLSSLRGFFPATVQPHKHCLRPICFPGYVPNS    981 - 1050
AVLQQMWLNAEPGASQDALWLWRPRPSQTQWQRKLLQWMGEKPGEEGEEDKKEEEEEKEDEELDWALASL   1051 - 1120
SPHSNQQLDSWELEDQSAVDWTQEPRRRSCKVARTHPHPWHRHGSLLLDEHYGHLPKFLHFFIYQTWFKK   1121 - 1190
LFPIFSLQAYPEAGTIEGLASLLVALLEKTTWVDRVHILQVLLRLLPNMSSDLQGQLQGLLVHLLNLDQP   1191 - 1260
PSLQDQTQKKFVILALQLLLACSLESRDVVLELMSYFLYSPVHCRPELKKLLHGLGLQDPEGFLFKEMMT   1261 - 1330
WVQGPDLDSKAGLRTCCHQKLEDMIQELQETPSQTSVVSGAPTRASVIPSGTSWSASGIFGRLSQVSEVP   1331 - 1400
LMVVSPAEPHSLAPELQAQRMLAPKRSWGTPQLRLRVLSETLKSFCLEPEARLHPAGPAQLPGEPPPLEE   1401 - 1470
TDWSHSQLLDLGPIDALNFFCEQLRAQQRSSLQEKAAHPHPPEPYTVAPVPDMVVPPPREHWYHPILRLQ   1471 - 1540
EAKPQRSARSAMRLRGPMRSRLCAGRTLDGPIRTLKLPLPRVEPQPFPLDWPMPPRPLPPRLLQPALQRY   1541 - 1610
FLPADADPDTYS                                                             1611 - 1622
//

Text Mined References (3)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
11347906 2001 Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.