Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.33
PubTator Score 0.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Endometrial cancer 311 0.0 0.6

Expression

AA Sequence

MFFKMKNEIDNDPESEKCIKDSTIMRREPQNILSPLMLPNLEIPFSVKDIISRIERAQLHRAREDIDMQL      1 - 70
SEIMNNVHRIMTRYTLVFNSSSERNVSLTEHKKKQRTNFLEKMATYAKTIEIREKTLANILAWLEEWNDV     71 - 140
LSEMTLMDVDEHHHWIAQMELLPDTLKAIENNVKILSRFSTSFLDEKKKQKKKILSRGTLWKSWKERVIK    141 - 210
RPSTARALRPDQMISDQLATNTKVSEIQGMLQELIGTTMFSTLENNAIKYISSTIVNLSTALSMLNDELK    211 - 280
CVNFQSSTVYAHETSEAEKELSLKIIRDLSNENEMLQQKLQDAEEKCEQLIRSKIVIEQLYAKLSTSSTL    281 - 350
KVLPGPSPQSSRAIIKVGDTEDNMDNILDKELENIVDEVQRKETKDSGIKWDSTISYTAQAERTPDLTEL    351 - 420
RQQPVASEDISEDSTKDNVSLKKGDFYQEDETDEYQSWKRSHKKATYVYETSGPNLSDNKSGQKVSEAKP    421 - 490
SQYYELQVLKKKRKEMKSFSEDKSKSPTEAKRKHLSLTETKSQGGKSGTSMMMLEQFRKVKRESPFDKRP    491 - 560
TAAEIKVEPTTESLDKEGKGEIRSLVEPLSMIQFDDTAEPQKGKIKGKKHHISSGTITSKEEKTEEKEEL    561 - 630
TKQVKSHQLVKSLSRVAKETSESTRVLESPDGKSEQSNLEEFQEAIMAFLKQKIDNIGKAFDKKTVPKEE    631 - 700
ELLKRAEAEKLGIIKAKMEEYFQKVAETVTKILRKYKDTKKEEQVGEKPIKQKKVVSFMPGLHFQKSPIS    701 - 770
AKSESSTLLSYESTDPVINNLIQMILAEIESERDIPTVSTVQKDHKEKEKQRQEQYLQEGQEQMSGMSLK    771 - 840
QQLLGERNLLKEHYEKISENWEEKKAWLQMKEGKQEQQSQKQWQEEEMWKEEQKQATPKQAEQEEKQKQR    841 - 910
GQEEEELPKSSLQRLEEGTQKMKTQGLLLEKENGQMRQIQKEAKHLGPHRRREKGKEKQKPERGLEDLER    911 - 980
QIKTKDQMQMKETQPKELEKMVIQTPMTLSPRWKSVLKDVQRSYEGKEFQRNLKTLENLPDEKEPISITP    981 - 1050
PPSLQYSLPGALPISGQPLTKCIHLTPQQAQEVGITLTPQQAQAQGITLTLQQAQELGIPLTPQQAQALE   1051 - 1120
ILFTPQQAQALGIPLTPQQTQVQGITLTPQQDQAPGISLTTQQAQKLGIPLTPQQAQALGIPLTPQQAQE   1121 - 1190
LGIPLTPQQAQALRVSLTPQQAQELGIPLTPQQAQALGITLTLQQAQQLGIPLTPQQAQALGITLTPKQV   1191 - 1260
QELGIPLTPQQAQALGITLTPKQAQELGIPLNPQQAQTLGIPLTPKQAQALGIPFTPQQAQALGIPLTPQ   1261 - 1330
QAQTQEITLTPQQAQALGMPLTTQQAQELGIPLTPQHAQALGMPLTTQQAQELGIPLTPQQAQALGMPLT   1331 - 1400
TQQAQELGIPLTPQQAQELGIPFTPQQAQAQEITLTPQQAQALGMPLTAQQAQELGITLTPQQAQELGIP   1401 - 1470
LTPQQAQALGIPLIPPQAQELGIPLTPQQAQALGILLIPPQAQELGIPLTPQQAQALGIPLIPPQAQELG   1471 - 1540
IPLTPQQVQALGIPLIPPQAQELEIPLTPQQAQALGIPLTPQQAQELGIPLTPQQAQELGIPLTPQQAQA   1541 - 1610
QGIPLTPQQAQALGISLTPQQAQAQGITLTPQQAQALGVPITPVNAWVSAVTLTSEQTHALESPMNLEQA   1611 - 1680
QEQLLKLGVPLTLDKAHTLGSPLTLKQVQWSHRPFQKSKASLPTGQSIISRLSPSLRLSLASSAPTAEKS   1681 - 1750
SIFGVSSTPLQISRVPLNQGPFAPGKPLEMGILSEPGKLGAPQTLRSSGQTLVYGGQSTSAQFPAPQAPP   1751 - 1820
SPGQLPISRAPPTPGQPFIAGVPPTSGQIPSLWAPLSPGQPLVPEASSIPGDLLESGPLTFSEQLQEFQP   1821 - 1890
PATAEQSPYLQAPSTPGQHLATWTLPGRASSLWIPPTSRHPPTLWPSPAPGKPQKSWSPSVAKKRLAIIS   1891 - 1960
SLKSKSVLIHPSAPDFKVAQVPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTP   1961 - 2030
YTDERALLTLMKPTTSPSSLTTLLRTSQISPLEWYQKSRFPPIDKPWILSSVSDTKKPKVMVPPSSPQEL   2031 - 2100
EEKRYFVDVEAQKKNLILLNQAIKTCGLPSQLHTMARTLIIEILHMDTVQLGYLFRKYIAYRLIQHARNN   2101 - 2170
IMKRLKAIQNTGKGYEARNLHMMLSRLDDYGKKVMQVWTEKQKSLGQKRNQCLKKMIHVFNQLKKIHELN   2171 - 2240
LSQPIPLIIEEKQIPASTTFVQKPFLKLLMEEDRTSDICKKFRQQEDQTEAIWNVDLSTSSYPIAEKTSM   2241 - 2310
HSLWAQLGGYPDIPRLLQLEVQSTFRKSLASLQSRVKKIPK                                2311 - 2351
//

Text Mined References (4)

PMID Year Title