Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

Gene RIF (1)

PMID Text
18483763 Unique PABP2 gene plays a critical role in human embryo cleavage; cDNA has been isolated and sequenced.

AA Sequence

MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEEDQDGDAGFLLS      1 - 70
LLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTAAGQLLSPETVGCPLSGTPEE     71 - 140
KVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTILCDKFSGHPKGYAYIEFATKGSVQAAVELDQS    141 - 210
LFRGRVIKVLPKRTNFPGISSTDRGGLRGHPGSRGAPFPHSGLQGRPRLRPQGQNRARGKFSPWFSPY      211 - 278
//

Publication (6)

PMID Year Title
18483763 2008 Isolation of the human ePAB and ePABP2 cDNAs and analysis of the expression patterns.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380618 2004 Identification of a novel Xenopus laevis poly (A) binding protein.
15083517 2004 Xenopus embryonic poly(A) binding protein 2 (ePABP2) defines a new family of cytoplasmic poly(A) binding proteins expressed during the early stages of vertebrate development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.