Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
relapsing-remitting multiple sclerosis 18 3.045 1.5

Expression

Gene RIF (1)

AA Sequence

MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEEDQDGDAGFLLS      1 - 70
LLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTAAGQLLSPETVGCPLSGTPEE     71 - 140
KVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTILCDKFSGHPKGYAYIEFATKGSVQAAVELDQS    141 - 210
LFRGRVIKVLPKRTNFPGISSTDRGGLRGHPGSRGAPFPHSGLQGRPRLRPQGQNRARGKFSPWFSPY      211 - 278
//

Text Mined References (6)

PMID Year Title