Property Summary

NCBI Gene PubMed Count 4
PubMed Score 1.83
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Expression

Gene RIF (1)

PMID Text
18483763 Unique PABP2 gene plays a critical role in human embryo cleavage; cDNA has been isolated and sequenced.

AA Sequence

MWPFPSRSLFPPPTQAWLQTVSSDPEAQGWGAWNETKEILGPEGGEGKEEKEEEEDAEEDQDGDAGFLLS      1 - 70
LLEQENLAECPLPDQELEAIKMKVCAMEQAEGTPRPPGVQQQAEEEEGTAAGQLLSPETVGCPLSGTPEE     71 - 140
KVEADHRSVYVGNVDYGGSAEELEAHFSRCGEVHRVTILCDKFSGHPKGYAYIEFATKGSVQAAVELDQS    141 - 210
LFRGRVIKVLPKRTNFPGISSTDRGGLRGHPGSRGAPFPHSGLQGRPRLRPQGQNRARGKFSPWFSPY      211 - 278
//

Text Mined References (6)

PMID Year Title
18483763 2008 Isolation of the human ePAB and ePABP2 cDNAs and analysis of the expression patterns.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15380618 2004 Identification of a novel Xenopus laevis poly (A) binding protein.
15083517 2004 Xenopus embryonic poly(A) binding protein 2 (ePABP2) defines a new family of cytoplasmic poly(A) binding proteins expressed during the early stages of vertebrate development.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.