Knowledge Summary

Patent

No data available

AA Sequence

MYVSISFLLGLSHLVLCCLLTFIVNFYLPPESIDFEFMAHNWSKGRSPSSTLGLSWFKAGFRFSDGWSMF      1 - 70
YSSGLPGVALPGSPPRSHLLPGTQILIRSFQPCESAKHSARLSSLLTTTSYSVS                     71 - 124
//

Text Mined References (1)

PMID Year Title
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.