Property Summary

NCBI Gene PubMed Count 27
PubMed Score 24.41
PubTator Score 34.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.200 0.001
medulloblastoma, large-cell -1.300 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.001
adult high grade glioma -1.300 0.000
ovarian cancer -1.900 0.000
psoriasis -1.200 0.000

Synonym

Accession A6NDV4 B3KQF3 O75539 Q49AB1 Q4KMX5 Q5TCW5 Q9HBY2 Q9P0U7
Symbols NAG5
NGX6
NAG-5
C9orf127

Gene

PANTHER Protein Class (1)

Gene RIF (18)

PMID Text
26261522 Ultrasonographic features are associated with NGX6 expression in invasive ductal breast carcinoma. NGX6 is involved in the invasion and metastasis activity of IDBC.
25882097 From our analysis, variants in the genes ABCB4, TP53AIP1, ARHGAP32 and TMEM88B were identified linked to the alexithymia phenotype.
25378401 The seven-transmembrane domain of NGX6a was found to be the critical region for the degradation of NGX6a, and the amino terminus of ezrin is required for the induction of NGX6a degradation.
25029911 These results demonstrate that Egr-1 regulates NGX6 gene transcription through an overlapping Sp1/Egr-1 binding site as a positive regulator of NGX6 gene.
24338274 downregulation of NGX6 expression contributes to the development and progression of gastric cancer
23588848 the levels of the NGX6 protein and mRNA were lower in patients with tamoxifen-resistant tumors compared to patients with tamoxifen-sensitive tumors
23053953 The present study was aimed to investigate the possible association between 19-base pair (bp) deletion polymorphism of the DHFR gene (rs70991108), null genotype of UGT2B17 as well as the expression level of NGX6 with the risk of breast cancer.
22647848 Data suggest that nasopharyngeal carcinoma-associated gene 6 (NGX6) may inhibit colon cancer through the regulation of proteins involved in cell proliferation, metastasis, apoptosis, cytoskeletal structure, metabolism, and signal transduction.
21464545 NGX6 could inhibit the expression of Wnt signaling downstream target genes in colon cancer.
20859756 NGX6 plays an important role in regulation of apoptosis, mobility/migration, and hydrolase as well as activity of JNK and Notch pathways through NGX6-mediated miRNA expression
More...

AA Sequence

MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAV      1 - 70
FAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRV     71 - 140
ARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACE    141 - 210
CKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQ    211 - 280
PGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPS    281 - 350
LFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS    351 - 420
VGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS                      421 - 472
//

Text Mined References (28)

PMID Year Title
26261522 2015 Association of ultrasonographic features with NGX6 expression and prognosis in invasive ductal breast carcinoma.
25882097 2015 Analysis of functional variants reveals new candidate genes associated with alexithymia.
25378401 2014 NGX6a is degraded through a proteasome-dependent pathway without ubiquitination mediated by ezrin, a cytoskeleton-membrane linker.
25029911 2014 Egr-1 regulates the transcription of NGX6 gene through a Sp1/Egr-1 overlapping site in the promoter.
24338274 2014 DNA promoter and histone H3 methylation downregulate NGX6 in gastric cancer cells.
23588848 2013 NGX6 expression improves the sensitivity of tamoxifen-resistant MCF-7 cells through modulation of the Smad signaling pathway.
23053953 2012 Evaluation of UDP-glucuronosyltransferase 2B17 (UGT2B17) and dihydrofolate reductase (DHFR) genes deletion and the expression level of NGX6 mRNA in breast cancer.
22647848 2012 Tumor suppressor gene NGX6 induces changes in protein expression profiles in colon cancer HT-29 cells.
21464545 2011 [Role of NGX6 in Wnt/?-catenin signaling pathway in colon cancer].
20859756 2010 Differential miRNA expression and their target genes between NGX6-positive and negative colon cancer cells.
More...