Property Summary

NCBI Gene PubMed Count 28
PubMed Score 25.58
PubTator Score 34.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 2.3e-05
atypical teratoid / rhabdoid tumor -1.100 1.5e-06
glioblastoma -1.200 6.4e-04
intraductal papillary-mucinous neoplasm ... 1.600 1.5e-03
medulloblastoma, large-cell -1.300 1.4e-04
ovarian cancer -1.900 2.1e-13
psoriasis -1.200 2.0e-61

Gene RIF (19)

AA Sequence

MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFSVHFYIFFGPSVALPPERPAV      1 - 70
FAMRLLPVLDSGGVLSLELQLNASSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRV     71 - 140
ARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACE    141 - 210
CKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTFYHACDQ    211 - 280
PGIVVFCIMDYDVLQFCDFLGSLMSVWVTVIAMARLQPVVKQVLYLLGAMLLSMALQLDRHGLWNLLGPS    281 - 350
LFALGILATAWTVRSVRRRHCYPPTWRRWLFYLCPGSLIAGSAVLLYAFVETRDNYFYIHSIWHMLIAGS    351 - 420
VGFLLPPRAKTDHGVPSGARARGCGYQLCINEQEELGLVGPGGATVSSICAS                      421 - 472
//

Text Mined References (29)

PMID Year Title