Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NDR6
Symbols MRG2
MEIS3
MEIS4

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MGPELGWGHPRGGDVCSSDSFNEDNTAFAKQVRSERPFFSSNPELDNLMIQAIQVLRFHLLELEKGKMPI      1 - 70
DLVIEDRDGGCREDFEDYPASCPSLPDQNNIWIRDHEDSGSVHLGTPGPSSGGLASQSGDNSSDQGVGLD     71 - 140
TSVASPSSGGEDEDLDQEPRRNKKRGIFPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNN    141 - 210
WFINARRRIVQPMIDQSNRTGQGAAFSPEGQPIGGYTETEPHVAFRAPASVGMSLNSEGEWHYL          211 - 274
//

Publication (4)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
9049632 1997 Identification of a conserved family of Meis1-related homeobox genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.