Knowledge Summary

Patent

No data available

Synonym

Accession A6NDN8
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MRGRRRAWRGAWRGGGAADLSLLCPQVAYVRARELHTLEVTGLETVAQSKAHVASLEGLIPEDKVVLLAG      1 - 70
SPLQNEATLGQCGVEALTTLEVVGRRLGVHNV                                           71 - 102
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).