Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Lung squamous cell carcinoma 10 3.75 1.9

Synonym

Accession A6NDN8
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MRGRRRAWRGAWRGGGAADLSLLCPQVAYVRARELHTLEVTGLETVAQSKAHVASLEGLIPEDKVVLLAG      1 - 70
SPLQNEATLGQCGVEALTTLEVVGRRLGVHNV                                           71 - 102
//

Text Mined References (2)

PMID Year Title