Knowledge Summary

Patent

No data available

Synonym

Accession A6NDN8
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MRGRRRAWRGAWRGGGAADLSLLCPQVAYVRARELHTLEVTGLETVAQSKAHVASLEGLIPEDKVVLLAG      1 - 70
SPLQNEATLGQCGVEALTTLEVVGRRLGVHNV                                           71 - 102
//

Publication (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).