Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NDL7
Symbols METTL21CP1

Gene

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
19773279 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIHFNLLETQLTPLASFQEIMKKTSIYHLPSFHYLMDSEAQEDTREAYDDKQVVTEIMARCFIPTLITTT      1 - 70
SWESFHFIGHEIRITEAMDCYGAVVWPSALVLCYFLETNAKQYNMVDKNVIEIGAGTGLVSIVASLLGAH     71 - 140
VTATDLPELLGNLQYNISRNTKMKSKHLPQVKELSWGVALDTNFPRSSNNFDYILAADVVYAHPFLEELL    141 - 210
ITFDHLCKETTIILWAMKFRLEKENKFVDRFKELFDLEEISSFPSLNIKLYKAVKKNRRSV             211 - 271
//

Publication (3)

PMID Year Title
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.