Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary


No data available


  Disease Relevance (1)

Disease Z-score Confidence
facioscapulohumeral dystrophy 286

AA Sequence

SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF                                          421 - 452

Text Mined References (2)

PMID Year Title
22144910 2011 Identification of a genomic reservoir for new TRIM genes in primate genomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.