Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
facioscapulohumeral dystrophy 286 2.33385060280925E-37

Synonym

Accession A6NDI0
Symbols

Gene

  Ortholog (2)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG

 GO Function (1)

 GO Component (1)

 Compartment GO Term (1)

AA Sequence

MNSGILQVFQRELICPICMNYFIDPVTIDCGHSFCRPCFYLNWKDSPFLVQCSECTKSTGQINLKTNIHF      1 - 70
KKMASLARKVSLWLFLSSEEQMCGTHRETKKMFCEVDRSLLCLLCSSSQEHRDHRHCPIESAAEEHQEKL     71 - 140
LQKMQSLWEKACENHRNLNVETTRTRCWKDYVNLRLEAIRAEYQKMPAFHHEEEKHNLEMLKKKGKDIFH    141 - 210
RLHLSKAKMAHRREILRGMYEELNEMCHKPDVELLQAFGDILHRSESVLLHMPQPLNPELSAGPITGLRD    211 - 280
RLNQFRVHITLHHEEANSDIFLCEILRSMCIGCDHQDVPYFTATPRSFLAWGAQTFTSGKYYWEVHVGDS    281 - 350
WNWAFGVCNMYWKEKNQNEKIDGEDGLFLLGCVKNDIQRSLFTTSPLLLQYIPRPTSRVGLFLDCEAKTV    351 - 420
SFVDVNQSSLIYTIPNCSFSPPLRPIFCCIHF                                          421 - 452
//

Text Mined References (2)

PMID Year Title
22144910 2011 Identification of a genomic reservoir for new TRIM genes in primate genomes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.