Property Summary

NCBI Gene PubMed Count 14
PubMed Score 30.04
PubTator Score 1178.63

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma -1.100 3.6e-03
Astrocytoma, Pilocytic -1.100 9.2e-08
Breast cancer 1.500 9.6e-18
ependymoma -1.400 4.7e-03
invasive ductal carcinoma 1.100 6.9e-03
medulloblastoma -1.100 3.3e-06
pancreatic cancer 1.100 7.8e-03
subependymal giant cell astrocytoma -1.032 3.2e-02
tuberculosis 1.200 3.3e-08

Synonym

Accession A6NDG6 G3PP
Symbols AUM
G3PP
PGPase

Gene

PGP

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (9)

AA Sequence

MAAAEAGGDDARCVRLSAERAQALLADVDTLLFDCDGVLWRGETAVPGAPEALRALRARGKRLGFITNNS      1 - 70
SKTRAAYAEKLRRLGFGGPAGPGASLEVFGTAYCTALYLRQRLAGAPAPKAYVLGSPALAAELEAVGVAS     71 - 140
VGVGPEPLQGEGPGDWLHAPLEPDVRAVVVGFDPHFSYMKLTKALRYLQQPGCLLVGTNMDNRLPLENGR    141 - 210
FIAGTGCLVRAVEMAAQRQADIIGKPSRFIFDCVSQEYGINPERTVMVGDRLDTDILLGATCGLKTILTL    211 - 280
TGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIADLLPALQG                                 281 - 321
//

Text Mined References (17)

PMID Year Title