Property Summary

NCBI Gene PubMed Count 3
PubMed Score 5.71
PubTator Score 2.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Astrocytoma, Pilocytic 1.100 7.8e-05
interstitial cystitis -1.700 1.6e-03
ovarian cancer 1.100 2.3e-03
pancreatic ductal adenocarcinoma liver m... -1.119 2.4e-02
psoriasis -1.300 1.2e-25

Gene RIF (1)

AA Sequence

MAESSLYRQRLEVIAEKRRLQEEIRAARREVEEEKLRVERLKRKSLRERWLMDGAAAVPEPSEDPTSKDP      1 - 70
QSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGHRPLSQSIVEAGSVGQTDLNK     71 - 140
RASLPAGLVGTPPESPSEPREDVLGFLPGPRQVPGAAGDSSEANGPCPSPIPTPEQGLSQRAVPSEGRVG    141 - 210
EAKGGGVVSVVWEGLRATEDCATGATGPELEAKVEEVVLEAIGDRKGAGSLELPAWVKEDRGIVEVVWEG    211 - 280
VGGSDAEAMGEIGRVPEVVQTSSPRLQERLEAAASIEGEDVPQGSPEGDGQGGSGGEEGSFIWVERVTLS    281 - 350
EEWEELLVEGLEGPEVAGRERGDESPLGAEGAKTGGGEETWEAEKRKAEESMGIGSEEKPGTGRDEAEMS    351 - 420
PVVERKGGEKKLELESRGSAEKLGTEREGGEEPLGIERKVEGHLRAEKEGDEEKRGAEEEEVEEPLGVEK    421 - 490
KGGEEEPEATKEPLEAERKGGEETLEAEKRGGEESLETEKTQGTEGDLNLEQGSREGSESQAEEMNEAGP    491 - 560
PLEANTETRPEKEGPQPQEKPVGALEEEGVKPQTAAEGQGPLGDATPLLAETPAPEQPAECQPLLQGEGP    561 - 630
SANPSAHPVPTYAPARQPEPSAPTEGEEASGPKQKTCQCCAVM                               631 - 673
//

Text Mined References (7)

PMID Year Title