Property Summary

NCBI Gene PubMed Count 3
PubMed Score 3.44
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
pancreatic ductal adenocarcinoma liver m... -1.119 0.024
interstitial cystitis -2.000 0.000
pilocytic astrocytoma 1.100 0.000
ovarian cancer 1.100 0.002
psoriasis -1.300 0.000

Gene RIF (1)

PMID Text
21187075 These results suggest that PALM3 may function as an adaptor in the LPS- Toll-like receptor 4 signaling and the interaction of SIGIRR with PALM3 may partly account for the mechanism of the negatively regulatory effect of SIGIRR.

AA Sequence

MAESSLYRQRLEVIAEKRRLQEEIRAARREVEEEKLRVERLKRKSLRERWLMDGAAAVPEPSEDPTSKDP      1 - 70
QSPEGQAQARIRNLEDSLFTLQSQLQLLQSASTGAQHKPSGRPSWRRQGHRPLSQSIVEAGSVGQTDLNK     71 - 140
RASLPAGLVGTPPESPSEPREDVLGFLPGPRQVPGAAGDSSEANGPCPSPIPTPEQGLSQRAVPSEGRVG    141 - 210
EAKGGGVVSVVWEGLRATEDCATGATGPELEAKVEEVVLEAIGDRKGAGSLELPAWVKEDRGIVEVVWEG    211 - 280
VGGSDAEAMGEIGRVPEVVQTSSPRLQERLEAAASIEGEDVPQGSPEGDGQGGSGGEEGSFIWVERVTLS    281 - 350
EEWEELLVEGLEGPEVAGRERGDESPLGAEGAKTGGGEETWEAEKRKAEESMGIGSEEKPGTGRDEAEMS    351 - 420
PVVERKGGEKKLELESRGSAEKLGTEREGGEEPLGIERKVEGHLRAEKEGDEEKRGAEEEEVEEPLGVEK    421 - 490
KGGEEEPEATKEPLEAERKGGEETLEAEKRGGEESLETEKTQGTEGDLNLEQGSREGSESQAEEMNEAGP    491 - 560
PLEANTETRPEKEGPQPQEKPVGALEEEGVKPQTAAEGQGPLGDATPLLAETPAPEQPAECQPLLQGEGP    561 - 630
SANPSAHPVPTYAPARQPEPSAPTEGEEASGPKQKTCQCCAVM                               631 - 673
//

Text Mined References (7)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21187075 2011 A novel binding protein of single immunoglobulin IL-1 receptor-related molecule: Paralemmin-3.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
15057824 2004 The DNA sequence and biology of human chromosome 19.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.