Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent (34)

AA Sequence

PMLNPFIYTLRNKQVKDVFKHTVKKIELFSMK                                          281 - 312

Text Mined References (4)

PMID Year Title
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
16541075 2006 The finished DNA sequence of human chromosome 12.
14983052 2004 The human olfactory receptor gene family.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.