Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NCS6
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MERELEALAARLARPAEPPFQALVEAAGGRGQVLLVGELWEREQSRALLRDFARAVFPPEPGAAKPGGAA      1 - 70
AEGAGPGAARGAQRAARAAGAAGAAAAAARAIRSPLVFVLCRASSLAAREPRRRLREMLRDVRGRRRAGA     71 - 140
ALVGVLVAEAGPEDAVAPGLRLLEALLRAVFGRQAGGPVQAAAYCPGLPASCLAVQAAACRALQAAGAGQ    141 - 210
PVEGAWERPGLPGLLACFSWGPWSRRKNQDVAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKAC    211 - 280
DGVVHTPAEPTGDSR                                                           281 - 295
//

Publication (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.