Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.300 5.4e-03
group 3 medulloblastoma -2.000 4.7e-05
medulloblastoma, large-cell -1.700 2.7e-04
pancreatic ductal adenocarcinoma liver m... -1.117 3.0e-02
psoriasis -1.700 3.8e-21

AA Sequence

MERELEALAARLARPAEPPFQALVEAAGGRGQVLLVGELWEREQSRALLRDFARAVFPPEPGAAKPGGAA      1 - 70
AEGAGPGAARGAQRAARAAGAAGAAAAAARAIRSPLVFVLCRASSLAAREPRRRLREMLRDVRGRRRAGA     71 - 140
ALVGVLVAEAGPEDAVAPGLRLLEALLRAVFGRQAGGPVQAAAYCPGLPASCLAVQAAACRALQAAGAGQ    141 - 210
PVEGAWERPGLPGLLACFSWGPWSRRKNQDVAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKAC    211 - 280
DGVVHTPAEPTGDSR                                                           281 - 295
//

Text Mined References (6)

PMID Year Title