Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 3.75986356371456E-21
sonic hedgehog group medulloblastoma 1482 1.25426600513534E-7
medulloblastoma, large-cell 6234 5.92609044879351E-5
atypical teratoid / rhabdoid tumor 4369 1.42454017588815E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00282738433631866

Expression

AA Sequence

MERELEALAARLARPAEPPFQALVEAAGGRGQVLLVGELWEREQSRALLRDFARAVFPPEPGAAKPGGAA      1 - 70
AEGAGPGAARGAQRAARAAGAAGAAAAAARAIRSPLVFVLCRASSLAAREPRRRLREMLRDVRGRRRAGA     71 - 140
ALVGVLVAEAGPEDAVAPGLRLLEALLRAVFGRQAGGPVQAAAYCPGLPASCLAVQAAACRALQAAGAGQ    141 - 210
PVEGAWERPGLPGLLACFSWGPWSRRKNQDVAACRSSAQEDFQEPEEELPLTAIFPNGDCDDLGRGSKAC    211 - 280
DGVVHTPAEPTGDSR                                                           281 - 295
//

Text Mined References (6)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
11752456 2001 Insight into hepatocellular carcinogenesis at transcriptome level by comparing gene expression profiles of hepatocellular carcinoma with those of corresponding noncancerous liver.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.