Property Summary

NCBI Gene PubMed Count 11
PubMed Score 1092.17
PubTator Score 8.09

Knowledge Summary

Patent

No data available

Gene RIF (6)

AA Sequence

MLLSPVTSTPFSVKDILRLERERSCPAASPHPRVRKSPENFQYLRMDAEPRGSEVHNAGGGGGDRKLDGS      1 - 70
EPPGGPCEAVLEMDAERMGEPQPGLNAASPLGGGTRVPERGVGNSGDSVRGGRSEQPKARQRRKPRVLFS     71 - 140
QAQVLALERRFKQQRYLSAPEREHLASALQLTSTQVKIWFQNRRYKCKRQRQDKSLELAGHPLTPRRVAV    141 - 210
PVLVRDGKPCLGPGPGAPAFPSPYSAAVSPYSCYGGYSGAPYGAGYGTCYAGAPSGPAPHTPLASAGFGH    211 - 280
GGQNATPQGHLAATLQGVRAW                                                     281 - 301
//

Text Mined References (12)

PMID Year Title