Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,683

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.100 0.000

Synonym

Accession A6NCQ9
Symbols

Gene

PANTHER Protein Class (2)

AA Sequence

MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTLVCPICRYVTFL      1 - 70
SKKSSRWPSMLDKSSQTLAVPVGLPSVPPLDSLGHTNPLAASSPAWRPPPGQARPPGSPGQSAQLPLDLL     71 - 140
PSLPRESQIFVISRHGMPLGEQDSVLPRRSLAELSEASLAPRSARAFCCRSRALLLITLIAVVAVVAAIL    141 - 210
PWVLLVRKQA                                                                211 - 220
//

Publication (3)

PMID Year Title
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.