Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.5e-130

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.100 6.5e-130

AA Sequence

MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRTLVCPICRYVTFL      1 - 70
SKKSSRWPSMLDKSSQTLAVPVGLPSVPPLDSLGHTNPLAASSPAWRPPPGQARPPGSPGQSAQLPLDLL     71 - 140
PSLPRESQIFVISRHGMPLGEQDSVLPRRSLAELSEASLAPRSARAFCCRSRALLLITLIAVVAVVAAIL    141 - 210
PWVLLVRKQA                                                                211 - 220
//

Text Mined References (3)

PMID Year Title