Property Summary

NCBI Gene PubMed Count 5
PubMed Score 168.15

Knowledge Summary

Patent

No data available

TINX Plot

AA Sequence

MEANSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALTQEIDF      1 - 70
LRRLYEEEIRVLQSHISDTSVVVKMDNSRDLNMHCVITEIKAQYDDIATRSRAEAESWYRSKCEEMKATV     71 - 140
IRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAALSDARCKLAELEGALQKA    141 - 210
KQDMACLIREYQEVMNSKLAWTLRSPPTGACWRARSRGCVRALVL                             211 - 255
//

Text Mined References (6)

PMID Year Title