Property Summary

NCBI Gene PubMed Count 5
Grant Count 16
R01 Count 10
Funding $5,095,551.25
PubMed Score 161.59

Knowledge Summary

Patent

No data available

AA Sequence

MEANSGRLASELNHVQEVLEGYKKKYEEEVALRATAENEFVALKKDVDCAYLRKSDLEANVEALTQEIDF      1 - 70
LRRLYEEEIRVLQSHISDTSVVVKMDNSRDLNMHCVITEIKAQYDDIATRSRAEAESWYRSKCEEMKATV     71 - 140
IRHGETLRRTKEEINELNRMIQRLTAEVENAKCQNSKLEAAVAQSEQQGEAALSDARCKLAELEGALQKA    141 - 210
KQDMACLIREYQEVMNSKLAWTLRSPPTGACWRARSRGCVRALVL                             211 - 255
//

Text Mined References (6)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
16831889 2006 New consensus nomenclature for mammalian keratins.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
10692104 2000 Characterization of a 300 kbp region of human DNA containing the type II hair keratin gene domain.