Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
psoriasis 6,685

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.100 0.050

Synonym

Accession A6NCM1
Symbols IQCA1P1

Gene

 GO Function (1)

 Compartment GO Term (0)

AA Sequence

MSEGAYQRLWESSHATLQELLDQEQLLLEPAPDRERQSFQYRLASLYLHYLGLLRRFDTVYDQMVQPQKR      1 - 70
RLLRRLLDGVAGRVLELKDELVRADLCENHCLDRVLQDFKLTPADLEVPIPKYFLLEQSTTVRERGLILA     71 - 140
EILSRLEPVSSQKSFTGMHRTEAIILVQKAERARQGRLRATFMREIRRDEEQDGRIREDGWHKFSQGQAA    141 - 210
VTIQKVWKGYLQRKRTQQDRRMEMEFIGMLPSPNQVEHLSIISQPCLVEDVQRLRQMEKEEEFRAAMVKA    211 - 280
HDSLVETEGPDMKEKMKEQIRQWFIECHDLTGRFPDYPDASSGGSYSIFADKTPEQVRMELEMQMQENRK    281 - 350
KEQEKSKEKGKDEKEKKKGKEEKAKKGEVDAVLQVLPSKCIPMICAGHEEYLNTWKNRCESIHPSQNYDS    351 - 420
ETLREEKRKEVELEIRIQVDELMRQELRKLRLAVDKEKRPLRAPKKTPGKKTGKKKEKDLTSDRSVESLY    421 - 490
EELVISGLLRKSESVALKDYIGDFLYLGSTLSLVKKLPMPSLFDIRQNVALYAVLRLGSPDIHIMAPLIR    491 - 560
SILLVGPSGMGKKMLVKAVCTETGANLFDLSPENLLGKYPGRNGAQMMVHIVFKVARLLQPSVIWIGNAE    561 - 630
KNFYKKTPKEDKEMDPKRIKKDLTKALRLLTPGDRVMLIGTTSRPQLAEMRGLCRVYERILFMPRPDYAS    631 - 700
RYVLWKRMIEARGIQPTQHLDISALAKVSDGYTPGHILQAIQSVLSERRFLQLSKRPLVASEFLGQLVKL    701 - 770
DPVYREEEESLKDWYFKTPLGKKSMKHRMDQLEAEEAKLDKEKKKRK                           771 - 817
//

Text Mined References (3)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
11181995 2001 The sequence of the human genome.