Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13
PubTator Score 0.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma -1.800 0.000
glioblastoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.400 0.002
primitive neuroectodermal tumor -1.800 0.001
tuberculosis -1.200 0.000
fibroadenoma -1.300 0.015
adult high grade glioma -1.300 0.027
pilocytic astrocytoma -1.700 0.000
psoriasis -2.600 0.000
lung adenocarcinoma -1.100 0.000

AA Sequence

MVLLAGTGPEGGGARCMTPPPPSPPRGAQVEEDPADYEEFEDFSSLPDTRSIASDDSFYPFEDEEEHGVE      1 - 70
SAESVPEGVPESVPETATLLRAACANNVGLLRTLVRRGVSVEEAQETDRNGRTGLIVACYHGFVDTVVAL     71 - 140
AECPHVDVNWQDSEGNTALITAAQAGHAIITNYLLNYFPGLDLERRNAFGFTALMKAAMQGRTDCIRALM    141 - 210
LAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPELPPPPEAARKPAGSKNCL    211 - 280
QRLTDCVLSVLTPRSVRGPEDGGVLDHMVRMTTSLYSPAVAIVCQTVCPESPPSVGKRRLAVQEILAARA    281 - 350
ARGPQAQEEDEVGGAGQRGRTGQEDADSREGSPRAGLPPALGSRGPAAPAPRKASLLPLQRLRRRSVRPG    351 - 420
VVVPRVRVSKAPAPTFQPERPARKGSTKDSGHLQIPKWRYKEAKEEKRKAEEAEKKRQAEAQKERRTAPW    421 - 490
KKRT                                                                      491 - 494
//

Text Mined References (2)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.