Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.13
PubTator Score 0.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 8.40784690907376E-174
lung adenocarcinoma 2714 2.96881484513463E-14
posterior fossa group B ependymoma 1530 2.82982650836209E-7
glioblastoma 5572 1.16536040643277E-5
pilocytic astrocytoma 3086 6.33080110959261E-5
tuberculosis 1563 8.42481920222393E-5
primitive neuroectodermal tumor 3031 0.00116834342793688
atypical teratoid / rhabdoid tumor 4369 0.00170674163672919
fibroadenoma 557 0.0147394486904852
adult high grade glioma 2148 0.0272452503904813

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group B ependymoma -1.800 0.000
glioblastoma -1.300 0.000
atypical teratoid / rhabdoid tumor -1.400 0.002
primitive neuroectodermal tumor -1.800 0.001
tuberculosis -1.200 0.000
fibroadenoma -1.300 0.015
adult high grade glioma -1.300 0.027
pilocytic astrocytoma -1.700 0.000
psoriasis -2.600 0.000
lung adenocarcinoma -1.100 0.000

Synonym

Accession A6NCL7
Symbols

Gene

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG

 Compartment GO Term (2)

AA Sequence

MVLLAGTGPEGGGARCMTPPPPSPPRGAQVEEDPADYEEFEDFSSLPDTRSIASDDSFYPFEDEEEHGVE      1 - 70
SAESVPEGVPESVPETATLLRAACANNVGLLRTLVRRGVSVEEAQETDRNGRTGLIVACYHGFVDTVVAL     71 - 140
AECPHVDVNWQDSEGNTALITAAQAGHAIITNYLLNYFPGLDLERRNAFGFTALMKAAMQGRTDCIRALM    141 - 210
LAGADVHARDPRRGMSPQEWATYTGRVDAVRLMQRLLERPCPEQFWEKYRPELPPPPEAARKPAGSKNCL    211 - 280
QRLTDCVLSVLTPRSVRGPEDGGVLDHMVRMTTSLYSPAVAIVCQTVCPESPPSVGKRRLAVQEILAARA    281 - 350
ARGPQAQEEDEVGGAGQRGRTGQEDADSREGSPRAGLPPALGSRGPAAPAPRKASLLPLQRLRRRSVRPG    351 - 420
VVVPRVRVSKAPAPTFQPERPARKGSTKDSGHLQIPKWRYKEAKEEKRKAEEAEKKRQAEAQKERRTAPW    421 - 490
KKRT                                                                      491 - 494
//

Text Mined References (2)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.