Property Summary

NCBI Gene PubMed Count 4
PubMed Score 9.05
PubTator Score 4.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 2.3e-11
psoriasis 6694 4.3e-07
medulloblastoma, large-cell 6241 2.0e-04
adult high grade glioma 3801 2.0e-03
ependymoma 4679 3.2e-03
group 4 medulloblastoma 1855 5.9e-03
Disease Target Count Z-score Confidence
Alzheimer's disease 658 0.0 3.0

Expression

  Differential Expression (6)

Disease log2 FC p
adult high grade glioma 1.100 2.0e-03
ependymoma 1.200 3.2e-03
group 4 medulloblastoma 1.100 5.9e-03
medulloblastoma, large-cell 1.100 2.0e-04
ovarian cancer 1.200 2.3e-11
psoriasis -1.800 4.3e-07

Gene RIF (1)

AA Sequence

MNTILPCQDQYFVGGQSYNCPYSTTTSESSVDVSTETWVSFWAAGLLDNRELQQAPQAQESFSDSNFPLP      1 - 70
DLCSWEEAQLSSQLYRNKQLQDTLVQKEEELARLHEENNHLRQYLNSALVKCLEEKAKKLLSSDEFSKAY     71 - 140
GKFRKGKRKSKEQRYSPAEIPHPKNAKRNLSSEFANCEEQAGPPVDPWVLQTLGLKDLDTIDDTSSANYS    141 - 210
ALASHPRRVASTFSQFPDDAVDYKNIPREDMPIDYRGDRTTPLHSTATHGEDFHILSQLSNPPVGLKTLP    211 - 280
YYTAHVSPNKTEMAFSTSLSPHCNVKTHSFHQGQAFVRRDEEGGWKFTWVPKQS                    281 - 334
//

Text Mined References (4)

PMID Year Title