Property Summary

NCBI Gene PubMed Count 4
PubMed Score 8.83
PubTator Score 4.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group B ependymoma 1.400 0.001
medulloblastoma, large-cell 1.100 0.000
adult high grade glioma 1.100 0.002
group 4 medulloblastoma 1.100 0.006
ovarian cancer 1.200 0.000
psoriasis -1.800 0.000

Gene RIF (1)

PMID Text
26527144 The crystal structure of a GemC1 coiled-coil domain variant engineered for better solubility was determined to 2.2 A resolution.

AA Sequence

MNTILPCQDQYFVGGQSYNCPYSTTTSESSVDVSTETWVSFWAAGLLDNRELQQAPQAQESFSDSNFPLP      1 - 70
DLCSWEEAQLSSQLYRNKQLQDTLVQKEEELARLHEENNHLRQYLNSALVKCLEEKAKKLLSSDEFSKAY     71 - 140
GKFRKGKRKSKEQRYSPAEIPHPKNAKRNLSSEFANCEEQAGPPVDPWVLQTLGLKDLDTIDDTSSANYS    141 - 210
ALASHPRRVASTFSQFPDDAVDYKNIPREDMPIDYRGDRTTPLHSTATHGEDFHILSQLSNPPVGLKTLP    211 - 280
YYTAHVSPNKTEMAFSTSLSPHCNVKTHSFHQGQAFVRRDEEGGWKFTWVPKQS                    281 - 334
//

Text Mined References (4)

PMID Year Title
26527144 2015 The structure of the GemC1 coiled coil and its interaction with the Geminin family of coiled-coil proteins.
20855966 2010 GEMC1 is a novel TopBP1-interacting protein involved in chromosomal DNA replication.
20383140 2010 GEMC1 is a TopBP1-interacting protein required for chromosomal DNA replication.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.