Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Synonym

Accession A6NCK2
Symbols

Gene

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDSDFSHAFQKELTCVICLNYLVDPVTICCGHSFCRPCLCLSWEEAQSPANCPACREPSPKMDFKTNILL      1 - 70
KNLVTIARKASLWQFLSSEKQICGTHRQTKKMFCDMDKSLLCLLCSNSQEHGAHKHYPIEEAAEEDREKL     71 - 140
LKQMRILWKKIQENQRNLYEERRTAFLLRGDVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQ    141 - 210
QLQRSWVKMDQKSKHLKEMYQELMEMCHKPEVELLQDLGDIVARSESVLLHMPQPVNPELTAGPITGLVY    211 - 280
RLNRFRVEISFHFEVTNHNIRLFEDVRSWMFRRGPLNSDRSDYFAAWGARVFSFGKHYWELDVDNSCDWA    281 - 350
LGVCNNSWIRKNSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFESGSVSFLNVT    351 - 420
KSSLIWSYPAGSLTFPVRPFFYTGHR                                                421 - 446
//

Text Mined References (1)

PMID Year Title
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.