Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 4.8e-41
Disease Target Count Z-score Confidence
Facioscapulohumeral muscular dystrophy 26 4.319 2.2

 GO Function (1)

 GO Component (1)

 Compartment GO Term (0)

AA Sequence

MDSDFSHAFQKELTCVICLNYLVDPVTICCGHSFCRPCLCLSWEEAQSPANCPACREPSPKMDFKTNILL      1 - 70
KNLVTIARKASLWQFLSSEKQICGTHRQTKKMFCDMDKSLLCLLCSNSQEHGAHKHYPIEEAAEEDREKL     71 - 140
LKQMRILWKKIQENQRNLYEERRTAFLLRGDVVLRAQMIRNEYRKLHPVLHKEEKQHLERLNKEYQEIFQ    141 - 210
QLQRSWVKMDQKSKHLKEMYQELMEMCHKPEVELLQDLGDIVARSESVLLHMPQPVNPELTAGPITGLVY    211 - 280
RLNRFRVEISFHFEVTNHNIRLFEDVRSWMFRRGPLNSDRSDYFAAWGARVFSFGKHYWELDVDNSCDWA    281 - 350
LGVCNNSWIRKNSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFESGSVSFLNVT    351 - 420
KSSLIWSYPAGSLTFPVRPFFYTGHR                                                421 - 446
//

Text Mined References (1)

PMID Year Title