Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NCJ1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MQTLRQEAARPCIPSGTLEASFPAPLYSDDYLSLEGSRWPPAIRQATRWKYTPMGRDAAGQLWYTGLTNS      1 - 70
DAWEAWYNLPRAPASPFREAYNRWHSCYQHRECSMPSAYTQHLRETAWHDPIVPAQYQAPSTRWGSALWK     71 - 140
DRPIRGKEYVLNRNRYGVEPLWRASDYVPSLSAPQRPPGTTQNYREWVLEPYCPSTCQRSPPSLTPTPR     141 - 209
//

Text Mined References (1)

PMID Year Title
15057824 2004 The DNA sequence and biology of human chromosome 19.