Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 8.3e-05

Expression

AA Sequence

MVCYLYWETFPSISHLLKITLSARDCHVCGLNLFIFMDPVENQALHPVIMALILMPSLHCFGNILILLFL      1 - 70
KSPAQLFCRMSVDLALLFPHK                                                      71 - 91
//

Text Mined References (4)

PMID Year Title