Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NCF6
Symbols

Gene

PANTHER Protein Class (1)

 Compartment GO Term (0)

AA Sequence

MPHSQKSRHCELEQGLQAPKEAQGLVGVQVAEAEKVNTTASSSPSTLIQGTLEKVSASGTPGTPQSSQRV      1 - 70
CSPCTTIKATPWNQSDESSRSQEKKDPGASQALMLEKKVDELVKFLSVKYTTKQPITEAEMLKGVIKEHK     71 - 140
DHFPPIFMQAHECMEIVFGTDMKEVDPISHSCVLLKSLDLTYDRRLSDDQGMPKTGLLILTFGVILMEAN    141 - 210
CASEEKIWEVLNIIRVYAGWKDFIYGEPRKLITRDLVQEKYLECCQVSNSDPPRYKFPWGPRAHAETTKM    211 - 280
KVLEFFSRVSGSDASSFPLLYEEALRDEKEKAQAIIATMGGTTLMASAHSWAKSSSFSCPE             281 - 341
//

Text Mined References (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.