Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.48
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

 GO Function (1)

Gene RIF (2)

PMID Text
26115100 HIV-1 CA colocalizes with MAP1LC3B2 and MAP1LC3B2/SQSTM1 as demonstrated via fluorescence microscopy
26115100 HIV-1 CA colocalizes with MAP1LC3B2 and MAP1LC3B2/SQSTM1 as demonstrated via fluorescence microscopy

AA Sequence

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR      1 - 70
LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV                    71 - 125
//

Text Mined References (2)

PMID Year Title
19684603 2009 Germline genomic variants associated with childhood acute lymphoblastic leukemia.
16541075 2006 The finished DNA sequence of human chromosome 12.