Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.04
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 2.8

Expression

Gene RIF (2)

AA Sequence

MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR      1 - 70
LQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVCASQETFGMKLSV                    71 - 125
//

Text Mined References (2)

PMID Year Title