Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
substance-related disorder 105 1.0

AA Sequence

MSEEMDNITAEEIIDKHLQKDLDAEENQNVAKTLRGKVREKLKISKINKGEKSSTEQLIDSEIHQRSKLS      1 - 70
PQTEVSLDESLSFFILSGEEGSALGKSSEQRPVNRSYPKCFSLGVNLQNVAESEEEEFMKEFILTDILKV     71 - 140
KAADYEDDQEQIKKQKANIFVPSSSPVVNQRKLPKDMMPRILEDEGFYIQRKPEIYKKTCNKMENRLLKL    141 - 210
EEAKCWFGESGEIMSLPTPIKQSWNFRLNVRKEPLNPLLKTIYRKL                            211 - 256
//

Text Mined References (2)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.