Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 2.0e-07

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.100 2.0e-07

AA Sequence

MTQELSFQKFIEQSDLLGELKYDFNEKDEFRHTETQRPFVFNYYENVLEKNSKRYQALGHLLEQYIYELL      1 - 70
EKVCKLEKVYIPPEADKEEPRSFFFMSEKALTNHHSALLILLQDHGVFRAGQWSQQAIIHHGLQHGSQIP     71 - 140
CIQMALQAHYDVIVLNPNDNFVEPKVEKEWKGLLTQNIESSSLKMVQGGSFFSLQHPPKCIPKRCSNTPE    141 - 210
EHTAYIWDYFISKTEGKDIAFIVHGYGGLVFMDLLVRRRWEVMSKVYAVALIDSEHHVGHQLGSDVQLLA    211 - 280
WIKHHCREWVTSPKPLDKPAATVFKKEFPMVSAGTEKYILAPSSSLQSIFKYFKKALKARTTINFSRMPI    281 - 350
VTRSSTKRKQSA                                                              351 - 362
//

Text Mined References (2)

PMID Year Title