Property Summary

NCBI Gene PubMed Count 2
PubMed Score 6.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Hyperaldosteronism 35 3.297 1.6

AA Sequence

MLTPRKAFRTCSKESGLAETESCGQTHTWPRALAVLMGLWWPRDQKAGEEDLRFRERRPGLQATATGSGE      1 - 70
HGAFPVHSQGVWASTHWQGTAVCPLQTPPPDAFIRNNKVLS                                  71 - 111
//

Text Mined References (3)

PMID Year Title