Property Summary

NCBI Gene PubMed Count 2
PubMed Score 5.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hyperaldosteronism 27 3.251 1.6
psoriasis 6,685

AA Sequence

MLTPRKAFRTCSKESGLAETESCGQTHTWPRALAVLMGLWWPRDQKAGEEDLRFRERRPGLQATATGSGE      1 - 70
HGAFPVHSQGVWASTHWQGTAVCPLQTPPPDAFIRNNKVLS                                  71 - 111
//

Text Mined References (3)

PMID Year Title
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.