Property Summary

NCBI Gene PubMed Count 8
PubMed Score 0.99
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.048 0.028

Gene RIF (1)

PMID Text
25929859 TMEM150B, renamed as DRAM-3, is a modulator of both macroautophagy and cell survival under starvation conditions.

AA Sequence

MWGYLSLMPVFLAVWAISGVWIVFAIAVTNRTVDLSKGFPYISICGSFPPQSCIFSQVLNMGAALAAWIC      1 - 70
IVRYHQLRDWGVRRWPNQLILWTGLLCALGTSVVGNFQEKNQRPTHLAGAFLAFILGNVYFWLQLLLWRL     71 - 140
KRLPQPGAAWIGPLRLGLCSVCTILIVAMIVLHACSLRSVSAACEWVVAMLLFALFGLLAVDFSALESCT    141 - 210
LCVQPWPSLSPPPASPISLPVQL                                                   211 - 233
//

Text Mined References (9)

PMID Year Title
27321926 2016 Tentonin 3/TMEM150c Confers Distinct Mechanosensitive Currents in Dorsal-Root Ganglion Neurons with Proprioceptive Function.
25929859 2015 DRAM-3 modulates autophagy and promotes cell survival in the absence of glucose.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
23307926 2013 A genome-wide association study of early menopause and the combined impact of identified variants.
22267201 2012 Meta-analyses identify 13 loci associated with age at menopause and highlight DNA repair and immune pathways.
19448619 2009 Loci at chromosomes 13, 19 and 20 influence age at natural menopause.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.