Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.99
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
mucosa-associated lymphoid tissue lymphoma 484 2.8e-02

Expression

  Differential Expression (1)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.048 2.8e-02

 GO Process (1)

Gene RIF (2)

AA Sequence

MWGYLSLMPVFLAVWAISGVWIVFAIAVTNRTVDLSKGFPYISICGSFPPQSCIFSQVLNMGAALAAWIC      1 - 70
IVRYHQLRDWGVRRWPNQLILWTGLLCALGTSVVGNFQEKNQRPTHLAGAFLAFILGNVYFWLQLLLWRL     71 - 140
KRLPQPGAAWIGPLRLGLCSVCTILIVAMIVLHACSLRSVSAACEWVVAMLLFALFGLLAVDFSALESCT    141 - 210
LCVQPWPSLSPPPASPISLPVQL                                                   211 - 233
//

Text Mined References (10)

PMID Year Title