Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.68
PubTator Score 9.23

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
15790765 Dppa5 is specifically and differentially expressed in human cells that have pluripotency and can be used as a marker of pluripotent stem cells.

AA Sequence

MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV      1 - 70
YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK                             71 - 116
//

Text Mined References (12)

PMID Year Title
20146561 2010 Generation of induced pluripotent stem cells from human adipose-derived stem cells without c-MYC.
19221495 2009 The role of promoter CpG methylation in the epigenetic control of stem cell related genes during differentiation.
19129511 2009 Gene birth, death, and divergence: the different scenarios of reproduction-related gene evolution.
17967063 2007 Genome-wide profiling of DNA methylation reveals a class of normally methylated CpG island promoters.
17913455 2007 Atypical structure and phylogenomic evolution of the new eutherian oocyte- and embryo-expressed KHDC1/DPPA5/ECAT1/OOEP gene family.
16479162 2006 Diverse epigenetic profile of novel human embryonic stem cell lines.
16166252 Analysis of Esg1 expression in pluripotent cells and the germline reveals similarities with Oct4 and Sox2 and differences between human pluripotent cell lines.
16081659 Primary differentiation in the human blastocyst: comparative molecular portraits of inner cell mass and trophectoderm cells.
15790765 2005 Identification of developmental pluripotency associated 5 expression in human pluripotent stem cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...