Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.73
PubTator Score 9.23

Knowledge Summary

Patent

No data available

Synonym

Accession A6NC42 B2RPQ7 hDPPA5
Symbols ESG1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 MGI Phenotype (1)

 GWAS Trait (1)

 HCA RNA Cell Line (3)

Protein-protein Interaction (1)

Gene RIF (2)

AA Sequence

MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQVSKAMLELKALESSDLTEVVV      1 - 70
YGSYLYKLRTKWMLQSMAEWHRQRQERGMLKLAEAMNALELGPWMK                             71 - 116
//

Text Mined References (13)

PMID Year Title