Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.07
PubTator Score 0.08

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MLWFQGNSMQLARSSFGLFLRNCSASKTTLPVLTLFTKDPCPLCDEAKEVLKPYENRQPYKDQKLPGTRR      1 - 70
RRSPSSPSHPHMASQSGKRYNLTLNQVLSFDYDMGLDAPKTISSDCGAFYCLRMFKSPDMTCCFYPKQ       71 - 138
//

Text Mined References (2)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.