Property Summary

NCBI Gene PubMed Count 5
PubMed Score 3.67
PubTator Score 1.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 3.90927931691881E-8
astrocytoma 1493 5.78969115091933E-8
oligodendroglioma 2849 2.11575936242493E-7
posterior fossa group A ependymoma 1511 2.44385162137238E-7
atypical teratoid/rhabdoid tumor 1095 2.69224649623846E-4
Pick disease 1893 0.00127818663743574
pediatric high grade glioma 2712 0.00201841043539665
subependymal giant cell astrocytoma 2287 0.00253829084578343
group 3 medulloblastoma 2254 0.00300415649335924
pilocytic astrocytoma 3086 0.00490335425912675
gastric carcinoma 832 0.0103000790335898
progressive supranuclear palsy 674 0.0175336834392799
primitive neuroectodermal tumor 3031 0.0296210463226692

Expression

  Differential Expression (13)

Synonym

Accession A5YM72 A8K1M3 B4DFC6 E9PK38 F5H427 Q8N467 Q9P2F3
Symbols ATPGD1

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA Inparanoid
Rat OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
26206726 CNDP1 and CARNS are expressed in glomeruli and tubular cells; TauT is expressed in renal epithelial cells; CDNP1 may have a role in diabetic neuropathy
20097752 carnosine synthase is identified as ATP-grasp domain-containing protein 1

AA Sequence

MLLCLSPAWLMKVPAPGQPGEAALLVSKAVSFHPGGLTFLDDFVPPRRATYFLAGLGLGPGRGREAAELA      1 - 70
RDLTCPTGASAELARLLEDRLLTRQLLAQQGGVAVPATLAFTYKPPGLLRGGDASLGLRLVELSGKEGQE     71 - 140
TLVKEEVEAFLRSEALGDILQVAVKLSGWRWRGRQAWRLHPRAELGAVVDTVLALLEKLEEEESVLVEAV    141 - 210
YPPAQLPCSDGPSPGPGLAVRICAVVCRTQGDRPLLSKVVCGVGRGDRPLRHHNSLPRTLEVALAQCGLG    211 - 280
EEAQVAAVRQRVKAAAEAALAAVLALEAGLSAEQRGGRRAHTDFLGVDFALTAAGGVLTPVALELNGGLC    281 - 350
LEACGALEGLWAAPRLGPAADEAVAAPLVETMLRRSARCLMEGKQLLVVGAGGVSKKFVWEAARDYGLQL    351 - 420
HLVESDPNHFASQLVQTFIHFDMTEHRRDEENARLLAELVRARGLKLDGCFSYWDDCLVLTALLCQELGL    421 - 490
PCSSPAAMRLAKQKSLTQLHLLHHHGPPWPAPSLHAVPCCPLESEADVERAVHQVPLPGVMKLEFGAGAV    491 - 560
GVRLVEDAPQCHEHFSRITRDLQGEADHPGIGLGWGNAMLLMEFVEGTEHDVDLVLFGGRLLAAFVSDNG    561 - 630
PTRLPGFTETAACMPTGLAPEQEAQMVQAAFRCCLGCGLLDGVFNVELKLTGAGPRLIEINPRMGGFYLR    631 - 700
DWILELYGVDLLLAAVMVACGLRPALPTRPRARGHLVGVMCLVSQHLQALSSTASRETLQALHDRGLLRL    701 - 770
NLLEEALVPGEYEEPYCSVACAGPSPTEARLRLLGLCQGLGIDGPSYPVAHFLSHFK                 771 - 827
//

Text Mined References (8)

PMID Year Title
26206726 2015 Intrinsic carnosine metabolism in the human kidney.
24891507 2014 Metabolite proofreading in carnosine and homocarnosine synthesis: molecular identification of PM20D2 as ?-alanyl-lysine dipeptidase.
20097752 2010 Molecular identification of carnosine synthase as ATP-grasp domain-containing protein 1 (ATPGD1).
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.