Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A5YM69 Q6ZUI2
Symbols ARHGEF5L

Gene

 Compartment GO Term (0)

AA Sequence

MEAEEAQHGASPPISAIEEFSIIPEAPMRSSQVSALGLEAQEDEDPSYKWREEHRLSATQQSELRDVCDY      1 - 70
AIETMPSFPKEGSADVEPNQESLVAEACDTPEHWEAVPQSLAGRQARTLAPPELWACPIQSEHLDMAPFS     71 - 140
SDLGSEEEEVEFWPGLTSLTLGSGQAEEEEETSSDNSGQTRYYSPCEEHPAETNQNEGAESGTIRQGEEL    141 - 210
PSEELQESQGLLHPQEVQVLEEQGQQEAGFRGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQ    211 - 280
DVMLGRQGERMGLTGEPEGLNDGEWEQEDMERKAQGQGGPEQGEERKRELQVPEENRADSQDEKSQTFLG    281 - 350
KSEEVTGKQEDHGIKEKGVPVSGQEAKEPESWDGGRLGAVGRARSREEENEHHGPSMPALIAPEDSPHCD    351 - 420
LFPGASYLVTQIPGTQTESRAEELSPAALSPLLEPIRCSHQPISLLGSFLTEESPDKEKLLSVL          421 - 484
//

Text Mined References (6)

PMID Year Title