Property Summary

Ligand Count 2
NCBI Gene PubMed Count 16
PubMed Score 6.50
PubTator Score 11.14

Knowledge Summary

Patent (368)

Gene RIF (11)

AA Sequence

MEGSWFHRKRFSFYLLLGFLLQGRGVTFTINCSGFGQHGADPTALNSVFNRKPFRPVTNISVPTQVNISF      1 - 70
AMSAILDVNEQLHLLSSFLWLEMVWDNPFISWNPEECEGITKMSMAAKNLWLPDIFIIELMDVDKTPKGL     71 - 140
TAYVSNEGRIRYKKPMKVDSICNLDIFYFPFDQQNCTLTFSSFLYTVDSMLLDMEKEVWEITDASRNILQ    141 - 210
THGEWELLGLSKATAKLSRGGNLYDQIVFYVAIRRRPSLYVINLLVPSGFLVAIDALSFYLPVKSGNRVP    211 - 280
FKITLLLGYNVFLLMMSDLLPTSGTPLIGVYFALCLSLMVGSLLETIFITHLLHVATTQPPPLPRWLHSL    281 - 350
LLHCNSPGRCCPTAPQKENKGPGLTPTHLPGVKEPEVSAGQMPGPAEAELTGGSEWTRAQREHEAQKQHS    351 - 420
VELWLQFSHAMDAMLFRLYLLFMASSIITVICLWNT                                      421 - 456
//

Text Mined References (19)

PMID Year Title