Property Summary

NCBI Gene PubMed Count 25
PubMed Score 139.79
PubTator Score 59.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.000 9.4e-05
astrocytoma -1.100 2.3e-18
Astrocytoma, Pilocytic -1.500 9.7e-06
atypical teratoid / rhabdoid tumor -2.300 1.3e-09
ependymoma -1.200 4.8e-03
glioblastoma -1.500 1.0e-07
lung carcinoma 1.300 8.4e-29
medulloblastoma -1.100 8.9e-05
medulloblastoma, large-cell -1.900 3.2e-04
primitive neuroectodermal tumor -1.200 5.7e-03

Gene RIF (9)

AA Sequence

MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGRELGRVTAPCTPL      1 - 70
RGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAPGGLSRSWDLGGVSPPRPTPA     71 - 140
LGPGSNRKLRLEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPPERLATLFGGP    141 - 210
ADTGFLNQGDTWSSPREVSSHAQRIARAKWEFFYGSLDPPSSGAKPPEQAPPSPPGVGSRQGSGVAVGRA    211 - 280
AKYSETDLDTVPLRCYRETDIDEVLAEREEADSAIESQPSSEGPPGTAYPPAPRPGPLPGPHPSLGSGNE    281 - 350
DEDDDEAGGEEDVDDEVFEASEGARPGSRMPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSY    351 - 420
TSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPWTQRGEEEEAEAR    421 - 490
AKLAPGREPPSPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLALGSTDTLSNGQKADLEAAQR    491 - 560
LAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLA    561 - 630
HFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALY    631 - 700
SSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHAD    701 - 770
PDCRKTPRGKRGWKSFHGILKGMILYLQKEEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLR    771 - 840
TADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQEEQVRTHEAK    841 - 910
LKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLRVKLKAGSEELDAVEAALAQA    911 - 980
GSTEDGLPPSHSSPSLQPKPSSQPRAQRHSSEPRPGAGSGRRKP                              981 - 1024
//

Text Mined References (27)

PMID Year Title