Property Summary

NCBI Gene PubMed Count 25
Grant Count 31
R01 Count 23
Funding $6,051,078.21
PubMed Score 131.31
PubTator Score 59.98

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
posterior fossa group A ependymoma -2.100 0.000
astrocytoma -1.800 0.010
glioblastoma -2.200 0.000
medulloblastoma -1.400 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -1.900 0.000
primitive neuroectodermal tumor -1.200 0.006
adult high grade glioma -2.000 0.000
pilocytic astrocytoma -1.500 0.000
lung carcinoma 1.300 0.000

Gene RIF (9)

PMID Text
26330566 Arf GTPases are likely to be locally activated by EFA6 and in turn targeted to the Flemming body to complete cytokinesis.
25355626 PSD expression might be a useful biomarker for epigenetic-based gastric cancer early diagnosis and may lead to the identification of new targets for pharmacological intervention.
25114232 EFA6 is regulated by a negative feedback loop, which is mediated by an allosteric interaction of Arf6-GTP with a domain of EFA6 and monitors the activation of Arf1 and Arf6 differentially
23603394 EFA6 participates in activation of Arf6 around the cleavage furrow during cytokinesis.
22179719 Aberrant methylation of PSD occurs in UC-associated colorectal mucosa, enabling circumvention of Rac1 immune responses governing neutrophil chemotaxis and apoptosis, and plays a pivotal role in the mechanisms underlying UC-associated carcinogenesis.
22002136 Both levels of accumulation of F-actin and apoptosis were significantly decreased in specimens from UC patients with PSD methylation compared to those without PSD methylation.
19773279 Observational study of gene-disease association. (HuGE Navigator)
17579087 Pleckstrin is a critical molecule for proinflammatory cytokine secretion in response to elevated advanced glycation end products (AGE) in diabetes.
16385451 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAQGAMRFCSEGDCAISPPRCPRRWLPEGPVPQSPPASMYGSTGSLLRRVAGPGPRGRELGRVTAPCTPL      1 - 70
RGPPSPRVAPSPWAPSSPTGQPPPGAQSSVVIFRFVEKASVRPLNGLPAPGGLSRSWDLGGVSPPRPTPA     71 - 140
LGPGSNRKLRLEASTSDPLPARGGSALPGSRNLVHGPPAPPQVGADGLYSSLPNGLGGPPERLATLFGGP    141 - 210
ADTGFLNQGDTWSSPREVSSHAQRIARAKWEFFYGSLDPPSSGAKPPEQAPPSPPGVGSRQGSGVAVGRA    211 - 280
AKYSETDLDTVPLRCYRETDIDEVLAEREEADSAIESQPSSEGPPGTAYPPAPRPGPLPGPHPSLGSGNE    281 - 350
DEDDDEAGGEEDVDDEVFEASEGARPGSRMPLKSPVPFLPGTSPSADGPDSFSCVFEAILESHRAKGTSY    351 - 420
TSLASLEALASPGPTQSPFFTFELPPQPPAPRPDPPAPAPLAPLEPDSGTSSAADGPWTQRGEEEEAEAR    421 - 490
AKLAPGREPPSPCHSEDSLGLGAAPLGSEPPLSQLVSDSDSELDSTERLALGSTDTLSNGQKADLEAAQR    491 - 560
LAKRLYRLDGFRKADVARHLGKNNDFSKLVAGEYLKFFVFTGMTLDQALRVFLKELALMGETQERERVLA    561 - 630
HFSQRYFQCNPEALSSEDGAHTLTCALMLLNTDLHGHNIGKRMTCGDFIGNLEGLNDGGDFPRELLKALY    631 - 700
SSIKNEKLQWAIDEEELRRSLSELADPNPKVIKRISGGSGSGSSPFLDLTPEPGAAVYKHGALVRKVHAD    701 - 770
PDCRKTPRGKRGWKSFHGILKGMILYLQKEEYKPGKALSETELKNAISIHHALATRASDYSKRPHVFYLR    771 - 840
TADWRVFLFQAPSLEQMQSWITRINVVAAMFSAPPFPAAVSSQKKFSRPLLPSAATRLSQEEQVRTHEAK    841 - 910
LKAMASELREHRAAQLGKKGRGKEAEEQRQKEAYLEFEKSRYSTYAALLRVKLKAGSEELDAVEAALAQA    911 - 980
GSTEDGLPPSHSSPSLQPKPSSQPRAQRHSSEPRPGAGSGRRKP                              981 - 1024
//

Text Mined References (27)

PMID Year Title
26330566 2016 Class I Arfs (Arf1 and Arf3) and Arf6 are localized to the Flemming body and play important roles in cytokinesis.
25355626 2015 The Pleckstrin and Sec7 domain-containing gene as a novel epigenetic modification marker in human gastric cancer and its clinical significance.
25114232 2014 EFA6 controls Arf1 and Arf6 activation through a negative feedback loop.
23603394 2013 EFA6 activates Arf6 and participates in its targeting to the Flemming body during cytokinesis.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
22179719 2012 Aberrant methylation of PSD disturbs Rac1-mediated immune responses governing neutrophil chemotaxis and apoptosis in ulcerative colitis-associated carcinogenesis.
22002136 2012 Aberrant methylation of the Pleckstrin and Sec7 domain-containing gene is implicated in ulcerative colitis-associated carcinogenesis through its inhibitory effect on apoptosis.
20339350 2010 USP9x-mediated deubiquitination of EFA6 regulates de novo tight junction assembly.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19494129 2009 EFA6A encodes two isoforms with distinct biological activities in neuronal cells.
More...