Property Summary

NCBI Gene PubMed Count 17
PubMed Score 2.29
PubTator Score 1.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis 1.700 0.000
osteosarcoma -1.014 0.015
tuberculosis and treatment for 6 months -1.300 0.000
breast carcinoma 1.300 0.001
invasive ductal carcinoma 1.400 0.000
ovarian cancer 2.100 0.000

Synonym

Accession A5D8V6 Q8N3K4 hVps37C
Symbols

Gene

Gene RIF (4)

PMID Text
23924735 VPS37B and appeared to interact with ALG-2 in a stronger manner than TSG101 does
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
15509564 VPS37C as a functional component of mammalian endosomal sorting complex required for transport-I

AA Sequence

METLKDKTLQELEELQNDSEAIDQLALESPEVQDLQLEREMALATNRSLAERNLEFQGPLEISRSNLSDR      1 - 70
YQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAEKFLEGEVPLETFLENFSSMR     71 - 140
MLSHLRRVRVEKLQEVVRKPRASQELAGDAPPPRPPPPVRPVPQGTPPVVEEQPQPPLAMPPYPLPYSPS    141 - 210
PSLPVGPTAHGALPPAPFPVVSQPSFYSGPLGPTYPAAQLGPRGAAGYSWSPQRSMPPRPGYPGTPMGAS    211 - 280
GPGYPLRGGRAPSPGYPQQSPYPATGGKPPYPIQPQLPSFPGQPQPSVPLQPPYPPGPAPPYGFPPPPGP    281 - 350
AWPGY                                                                     351 - 355
//

Text Mined References (22)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23924735 2013 VPS37 isoforms differentially modulate the ternary complex formation of ALIX, ALG-2, and ESCRT-I.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
22405001 2012 The UBAP1 subunit of ESCRT-I interacts with ubiquitin via a SOUBA domain.
21270402 2011 TANK-binding kinase 1 attenuates PTAP-dependent retroviral budding through targeting endosomal sorting complex required for transport-I.
21269460 2011 Initial characterization of the human central proteome.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
More...