Property Summary

NCBI Gene PubMed Count 2
PubMed Score 3.21
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

AA Sequence

MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVVIFGPLL      1 - 70
QFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAVTARHLSRLVVGAAVWRGAGR     71 - 140
AFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAVFAKYLAH    141 - 210
GLPAGAPLRLVFLLNVLLLGLWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHG    211 - 280
LFPRPHSSRKHN                                                              281 - 292
//

Text Mined References (3)

PMID Year Title