Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.77
PubTator Score 2.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession A5D6W6 Q8IUQ7
Symbols FIT1

Gene

AA Sequence

MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWLAAVVIFGPLL      1 - 70
QFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAVTARHLSRLVVGAAVWRGAGR     71 - 140
AFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRGYTVSSHTFLLTFCCLLMAEEAAVFAKYLAH    141 - 210
GLPAGAPLRLVFLLNVLLLGLWNFLLLCTVIYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHG    211 - 280
LFPRPHSSRKHN                                                              281 - 292
//

Text Mined References (3)

PMID Year Title
18160536 2008 Evolutionarily conserved gene family important for fat storage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.