Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.2e-08
lung adenocarcinoma 2716 2.9e-06
lung cancer 4740 2.7e-04
Disease Target Count Z-score Confidence
Juvenile myoclonic epilepsy 21 4.396 2.2

Expression

  Differential Expression (3)

Disease log2 FC p
lung adenocarcinoma 1.100 2.9e-06
lung cancer 1.300 2.7e-04
osteosarcoma -2.266 3.2e-08

AA Sequence

MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI      1 - 70
LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA     71 - 140
KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK    141 - 210
AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC                                211 - 252
//

Text Mined References (6)

PMID Year Title