Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
osteosarcoma 7933 3.20346216147009E-8
lung adenocarcinoma 2714 2.91121889233427E-6
lung cancer 4473 2.7077112568527E-4

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -2.266 0.000
lung cancer 1.300 0.000
lung adenocarcinoma 1.100 0.000

Synonym

Accession A4QPB2 B0QYF3 B0QYF4 B2RPI5 LRP-5-like
Symbols

Gene

  Ortholog (1)

Species Source
Chimp OMA EggNOG Inparanoid

AA Sequence

MEGHVYWTDDEVWAIRRAYLDGSGAQTLINTKINDPDDIAVNWVARSLYWTHTGTEHIEVTCLNSTSHKI      1 - 70
LVSEDMDEPRAIALHPEMGLTYWIDWGENPEIKRANLDRQELRVLVNASLGWPNGLALDLQEGKLYWGDA     71 - 140
KTDKIEAISVDETKRQTLLKDKLPHIFRFTLLGDFIYWTAWQHHSIKRVHKVKANRDVIIDQLPDLMGLK    141 - 210
AVNVDKVVGTNPHADRNGGAATCASSRPTQPGLAAPSRAWNC                                211 - 252
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.