Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 9.1e-70
ependymoma 4679 2.0e-09
nasopharyngeal carcinoma 1058 8.0e-08
medulloblastoma 720 1.5e-06
medulloblastoma, large-cell 6241 8.7e-04
astrocytic glioma 2597 7.6e-03
chronic rhinosinusitis 512 3.2e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -1.400 7.6e-03
chronic rhinosinusitis -1.606 3.2e-02
ependymoma 2.700 2.0e-09
medulloblastoma -1.100 1.5e-06
medulloblastoma, large-cell -1.100 8.7e-04
nasopharyngeal carcinoma -2.100 8.0e-08
psoriasis -2.600 9.1e-70

Gene RIF (1)

AA Sequence

MEDDEEETTASTLRGKPRPPPVSAQSAFSYIPPRRLDPKEHSYYYRPARTGIISLYDCIFKRRLDYDQKL      1 - 70
HRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRANHVQADFYRKNDIPSLKEPG     71 - 140
FGHIAPS                                                                   141 - 147
//

Text Mined References (3)

PMID Year Title