Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.25
PubTator Score 0.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
posterior fossa group A ependymoma -1.500 0.000
glioblastoma -1.300 0.011
medulloblastoma -1.300 0.008
pilocytic astrocytoma -1.400 0.001
pituitary cancer 2.600 0.000
psoriasis -1.700 0.000

AA Sequence

MDELLLDLFHKLTSGRQLAAGNGLCGISHKEQEVWKPGHNILVKMRKEDKSLVWLIHSTLARYTQVTNFL      1 - 70
GTSRSSVTRCKPGANCPSSHSGISRQLSPLSVTEDSSAPILELQNQGSSGVCGHRVERQNRSADDGTQTH     71 - 140
SENSSQENRIKARCLSCTSMVLKGIWGLLIILSVSSSWVGTTQIVKITYKNFYCPFFMTWFSTNWNIMFF    141 - 210
PVYYSGHLATAQEKQSPMKKFRECSRIFGEDGLTLKLFLKRTAPFSILWTLTNYLYLLALKKLTATDVSA    211 - 280
LFCCNKAFVFLLSWIVLKDRFMGVRIVAAIMAITGIVMMAYADNFHADSIIGVAFAVGSASTSALYKVLF    281 - 350
KMFLGSANFGEAAHFVSTLGFFNLIFISFTPVILYFTKVEHWSSFAALPWGCLCGMAGLWLAFNILVNVG    351 - 420
VVLTYPILISIGTVLSVPGNAAVDLLKQEVIFNVVRLAATIIICIGFLLMLLPEEWDEITLRFINSLKEK    421 - 490
KSEEHVDDVTDPSIHLRGRGRANGTVSIPLA                                           491 - 521
//

Text Mined References (6)

PMID Year Title
21254220 2011 Propensity score-based nonparametric test revealing genetic variants underlying bipolar disorder.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
17554300 2007 Genome-wide association study of 14,000 cases of seven common diseases and 3,000 shared controls.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.