Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.33
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -3.431 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.007
non primary Sjogren syndrome sicca 1.100 0.025
Breast cancer 1.200 0.000
invasive ductal carcinoma 1.100 0.009
ovarian cancer 1.400 0.000

Synonym

Accession A4GXA9 Q8TEP2 Q96RY3
Symbols SLX2B
gs125

Gene

Gene RIF (4)

PMID Text
26804904 Avoiding damage formation through invalidation of Mus81-Eme2 and Mre11, or preventing damage signaling by turning off the ATM pathway, suppresses the replication phenotypes of Chk1-deficient cells.
24813886 Results define distinct and temporal roles for MUS81-EME1 and MUS81-EME2 in the maintenance of genome stability.
24692662 The presence of a 5' phosphate terminus at nicks and gaps rendered DNA significantly less susceptible to the cleavage by MUS81-EME2 than its absence.
24371268 The results indicate that MUS81-EME2 is a more active endonuclease than MUS81-EME1 and exhibits broader substrate specificity.

AA Sequence

MARVGPGRAGVSCQGRGRGRGGSGQRRPPTWEISDSDAEDSAGSEAAARARDPAGERRAAAEALRLLRPE      1 - 70
QVLKRLAVCVDTAILEDAGADVLMEALEALGCECRIEPQRPARSLRWTRASPDPCPRSLPPEVWAAGEQE     71 - 140
LLLLLEPEEFLQGVATLTQISGPTHWVPWISPETTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGA    141 - 210
EVAVSWPEVEEALVLLQLWANLDVLLVASWQELSRHVCAVTKALAQYPLKQYRESQAFSFCTAGRWAAGE    211 - 280
PVARDGAGLQAAWRRQIRQFSRVSPAVADAVVTAFPSPRLLQQALEACSTERERMGLLADLPVPPSEGGR    281 - 350
PRRVGPDLSRRICLFLTTANPDLLLDLGS                                             351 - 379
//

Text Mined References (9)

PMID Year Title
26804904 2016 Signaling from Mus81-Eme2-Dependent DNA Damage Elicited by Chk1 Deficiency Modulates Replication Fork Speed and Origin Usage.
24813886 2014 MUS81-EME2 promotes replication fork restart.
24692662 2014 Human MUS81-EME2 can cleave a variety of DNA structures including intact Holliday junction and nicked duplex.
24371268 2014 Substrate specificity of the MUS81-EME2 structure selective endonuclease.
17289582 2007 Identification of FAAP24, a Fanconi anemia core complex protein that interacts with FANCM.
12721304 2003 Identification and characterization of the human mus81-eme1 endonuclease.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.