Property Summary

NCBI Gene PubMed Count 8
PubMed Score 32.58
PubTator Score 4.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.200 5.0e-07
intraductal papillary-mucinous neoplasm ... 1.100 6.9e-03
invasive ductal carcinoma 1.100 9.1e-03
non primary Sjogren syndrome sicca 1.100 2.5e-02
osteosarcoma -1.152 5.3e-05
ovarian cancer 1.400 2.1e-08

Gene RIF (4)

AA Sequence

MARVGPGRAGVSCQGRGRGRGGSGQRRPPTWEISDSDAEDSAGSEAAARARDPAGERRAAAEALRLLRPE      1 - 70
QVLKRLAVCVDTAILEDAGADVLMEALEALGCECRIEPQRPARSLRWTRASPDPCPRSLPPEVWAAGEQE     71 - 140
LLLLLEPEEFLQGVATLTQISGPTHWVPWISPETTARPHLAVIGLDAYLWSRQHVSRGTQQPESPKVAGA    141 - 210
EVAVSWPEVEEALVLLQLWANLDVLLVASWQELSRHVCAVTKALAQYPLKQYRESQAFSFCTAGRWAAGE    211 - 280
PVARDGAGLQAAWRRQIRQFSRVSPAVADAVVTAFPSPRLLQQALEACSTERERMGLLADLPVPPSEGGR    281 - 350
PRRVGPDLSRRICLFLTTANPDLLLDLGS                                             351 - 379
//

Text Mined References (9)

PMID Year Title